Recombinant Arabidopsis thaliana Photosystem I reaction center subunit V, chloroplastic (PSAG)

Shipped with Ice Packs
In Stock

Description

Introduction to PSAG

PSAG (Photosystem I reaction center subunit V) is an integral membrane protein component of photosystem I (PSI) in Arabidopsis thaliana. It plays a critical role in stabilizing the PSI-LHCI supercomplex and facilitating electron transport between plastocyanin and PSI. With a molecular weight of 17.08 kDa (calculated from nucleotide sequence) or 11 kDa (observed in mature forms), PSAG is localized to chloroplast thylakoids and interacts with peripheral light-harvesting complex I (LHCI) proteins, particularly Lhca1 .

Recombinant Production Methods

Recombinant PSAG is produced using plant-based expression systems to preserve post-translational modifications. Key approaches include:

SystemMethod
Arabidopsis callus culturesTandem affinity purification (TAP) of tagged PSAG subunits
Super-expression platformOverexpression of PSAG in Arabidopsis with yields up to 0.4 mg/g FW
ChallengesMembrane protein solubility; need for native chloroplast environment

These methods enable structural studies of PSI-LHCI supercomplexes .

Functional Studies and Mutant Analysis

Knockout mutants (psag-1.4) show minimal phenotypic effects due to functional redundancy with other PSI subunits. Key findings:

StudyObservation
PSI StabilityPartial loss of LHCI-680 binding in psag mutants
Electron TransportImpaired P700 reduction rates in psag mutants lacking PsaK
ProteomicsRedox-regulated expression under fluctuating light conditions

PSAG interacts with plastocyanin via a "spontaneous" thylakoid insertion pathway, bypassing known chloroplast targeting machinery .

Applications in Research and Biotechnology

Recombinant PSAG is used in:

  1. Structural Biology: Characterizing PSI-LHCI interactions and electron transfer pathways .

  2. Antibody Development: PHY0106A/P PHY2769A antibodies target PSAG for immunoblotting and immunoprecipitation .

  3. Biotechnology: Testing plant-based platforms for producing complex membrane proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PSAG; At1g55670; F20N2.21; F20N2.33; F20N2_3; Photosystem I reaction center subunit V, chloroplastic; PSI-G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
61-160
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PSAG
Target Protein Sequence
ELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLK SNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGYDPSFFG
Uniprot No.

Target Background

Function
The function of this protein is currently unknown.
Gene References Into Functions
  1. The loop region of PSI-G is critical for proper integration into the PSI core. PMID: 16045770
Database Links

KEGG: ath:AT1G55670

STRING: 3702.AT1G55670.1

UniGene: At.16919

Protein Families
PsaG/PsaK family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the functional role of PSAG in photosynthetic efficiency?

The protein plays a crucial role in maintaining the proper PSII:PSI ratio, which is fundamental for photosynthetic efficiency. Research indicates that alterations in this ratio, as seen in some Arabidopsis mutants, can significantly affect chlorophyll fluorescence and photosynthetic operating efficiency. For example, the LCF1 mutant demonstrates that decreased PSII:PSI ratio correlates with higher φPSII (operating efficiency of Photosystem II) and lower levels of chlorophyll fluorescence .

Methodologically, to investigate PSAG's specific contributions, researchers should employ both in vivo chlorophyll fluorescence measurements and biochemical analysis of isolated thylakoid membranes to quantify electron transport rates through both photosystems.

How is PSAG expression regulated during chloroplast biogenesis?

PSAG expression is tightly regulated during chloroplast biogenesis through a complex process involving nuclear-encoded factors and chloroplast signals. Like other photosynthesis-associated proteins, PSAG is synthesized in the cytoplasm with cleavable targeting sequences and must be properly processed for functional integration into PSI.

During biogenesis, chloroplasts import most proteins associated with photosynthesis including PSAG. Research on conditional photosynthesis mutants (var2 and abc1k1) has demonstrated that proper protein processing is dependent on active photosynthesis . When photosynthesis is disrupted, as in these mutants under specific light conditions (680 nm red light), accumulation of incompletely cleaved processing intermediates occurs .

To study PSAG regulation experimentally:

  • Monitor expression patterns under different light qualities and quantities

  • Analyze processing intermediates using Western blotting

  • Employ mass spectrometry to detect protein modifications during biogenesis stages

  • Use conditional mutants that allow reversible arrest of chloroplast biogenesis

This approach reveals the interdependence between functional photosynthesis and proper protein processing, directly impacting PSAG integration into functional PSI complexes.

What structural features distinguish PSAG from other PSI subunits?

PSAG possesses distinctive structural features that differentiate it from other PSI subunits. The protein contains specific domains essential for its integration into the PSI complex and interaction with partner proteins. Unlike some other photosystem components that may have multiple isoforms, PSAG structure is highly conserved across plant species due to its fundamental role in PSI function.

A methodological approach to characterizing PSAG's structural uniqueness involves:

  • Comparative protein sequence analysis across species

  • Secondary and tertiary structure prediction using bioinformatics tools

  • X-ray crystallography or cryo-electron microscopy of isolated PSI complexes

  • Site-directed mutagenesis to identify critical functional domains

These approaches collectively provide insights into how PSAG's structure contributes to PSI assembly and function. Experimental validation through mutagenesis of conserved residues can further establish structure-function relationships.

What are the optimal systems for recombinant PSAG expression?

Successfully expressing recombinant PSAG requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and functional activity. Based on current research methodologies, several expression systems can be employed with varying advantages:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)Processing Efficiency
E. coliRapid growth, high yieldsLacks chloroplastic processing machinery5-10Low
Yeast (P. pastoris)Post-translational modificationsMedium complexity2-5Medium
Plant cell culturesNative-like processingSlow growth, lower yields0.5-2High
Transient expression in N. benthamianaNative-like environmentLabor intensive1-3Very high

The experimental protocol should include:

  • Codon optimization for the chosen expression system

  • Addition of appropriate targeting sequences if aiming for chloroplast localization

  • Careful optimization of induction conditions (temperature, inducer concentration)

  • Specialized extraction protocols for membrane-associated proteins

Each approach requires system-specific optimization to balance protein yield with proper folding and activity.

How should researchers optimize PSAG extraction from thylakoid membranes?

Extracting PSAG from thylakoid membranes presents unique challenges due to its membrane association and integration within the PSI complex. A methodological approach requires sequential solubilization steps:

  • Isolation of intact chloroplasts using Percoll gradient centrifugation

  • Preparation of thylakoid membranes through osmotic shock

  • Selective solubilization using a combination of detergents

The critical parameters affecting extraction efficiency include:

ParameterOptimal RangeEffect on PSAG Recovery
Detergent typen-dodecyl-β-D-maltoside (0.5-1%)Preserves protein-protein interactions
Salt concentration100-300 mM NaClDisrupts electrostatic interactions
pH7.0-8.0Maintains protein stability
Temperature4°C throughout procedurePrevents proteolytic degradation
Protease inhibitorsComplete cocktailEssential for preventing degradation

When extracting native PSAG from Arabidopsis, researchers should be aware that the protein exists in a complex with other PSI subunits. Complete solubilization may disrupt functional interactions, while insufficient solubilization results in poor yields. Finding this balance requires systematic optimization through detergent screening and quantification of protein recovery at each step.

What purification strategies yield the highest purity and activity of recombinant PSAG?

Purification of recombinant PSAG requires a multi-step strategy to achieve both high purity and preserved activity. Based on established methodologies for photosystem proteins, the following approach is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using a histidine tag

  • Intermediate purification: Ion exchange chromatography to separate based on charge properties

  • Polishing step: Size exclusion chromatography to achieve final purity and remove aggregates

A comparative analysis of purification strategies shows:

Purification StrategyPurity (%)Activity Retention (%)Throughput
Single-step IMAC70-8560-75High
IMAC + Ion Exchange85-9550-65Medium
IMAC + Size Exclusion90-9855-70Low
Complete three-step protocol>9845-60Very low

The purification protocol should be tailored based on the experimental requirements. For structural studies requiring exceptional purity, the complete three-step protocol is necessary despite lower activity retention. For functional studies, a balance must be struck between purity and activity preservation.

Critical methodological considerations include:

  • Maintaining detergent concentration above critical micelle concentration throughout purification

  • Inclusion of stabilizing agents (glycerol 10-15%, specific lipids)

  • Using mild elution conditions to preserve protein structure

  • Immediate assessment of protein activity after each purification step

The choice of purification tags (His, Strep, FLAG) can significantly impact both purity and activity, with Strep-tag often providing better results for photosystem proteins despite lower binding capacity.

How should researchers design experiments to evaluate PSAG function in vivo?

Designing robust experiments to evaluate PSAG function in living Arabidopsis plants requires careful consideration of genetic, physiological, and biochemical approaches. A comprehensive experimental design should include:

  • Genetic manipulation strategies:

    • CRISPR/Cas9 gene editing for precise mutations

    • RNAi or antisense approaches for knockdown studies

    • Complementation with modified PSAG variants to test specific hypotheses

  • Physiological measurements:

    • Chlorophyll fluorescence parameters (φPSII, NPQ, Fv/Fm)

    • P700 absorption changes to directly assess PSI activity

    • Gas exchange measurements to quantify photosynthetic carbon assimilation

  • Biochemical characterization:

    • PSI complex isolation and subunit composition analysis

    • Electron transport rate measurements in isolated thylakoids

    • Protein-protein interaction studies using co-immunoprecipitation

When designing these experiments, researchers must account for the high degree of functional redundancy in photosynthetic systems. The approach used in studies of LCF1 mutants demonstrates the importance of considering the PSII:PSI ratio rather than focusing solely on individual components . Similarly, conditional mutants like var2 and abc1k1 can provide valuable insights by allowing inducible disruption of photosynthesis under specific light conditions .

Control experiments should include:

  • Wild-type plants grown under identical conditions

  • Plants with mutations in related but distinct photosystem components

  • Recovery experiments to test the reversibility of observed phenotypes

Statistical power analysis should be conducted prior to experimentation to determine appropriate sample sizes, especially given the often subtle phenotypic changes in photosystem mutants.

What approaches effectively resolve contradictory data on PSAG function?

Contradictory findings regarding PSAG function are common in photosynthesis research due to variations in experimental conditions, genetic backgrounds, and measurement techniques. To effectively resolve such contradictions, researchers should implement a systematic meta-analysis approach similar to cross-species RNA-seq integration methods .

A methodological framework for resolving contradictions includes:

  • Standardized data collection and normalization:

    • Establish consistent growth conditions across experiments

    • Implement standardized measurement protocols

    • Normalize data using robust statistical methods to account for experimental variation

  • Meta-analysis of published results:

    • Apply statistical methods like Fisher's combined probability test to merge p-values across studies

    • Calculate log ratio of means (ROM) to quantify effect sizes across diverse datasets

    • Implement random-effects models to account for between-study heterogeneity

  • Machine learning approaches for pattern identification:

    • Apply supervised learning algorithms (information gain, chi-squared, SVM, Gini index) to identify discriminatory variables

    • Remove useless and correlated attributes through data cleaning

    • Normalize results to values between 0 and 1 for comparison

  • Validation experiments addressing specific contradictions:

    • Design targeted experiments to directly test contradictory findings

    • Include all relevant controls and variables identified in meta-analysis

    • Employ multiple independent measurement techniques

This approach successfully identified key metabolic pathways and resolved contradictory information in meta-analyses of transcriptional regulation in algal species , and similar principles can be applied to PSAG research in Arabidopsis.

How can researchers accurately measure PSAG-specific contributions to photosynthetic efficiency?

  • Genetic strategies for specific PSAG manipulation:

    • Inducible expression systems to control PSAG levels temporally

    • Point mutations affecting specific functions rather than complete knockouts

    • Complementation with modified PSAG variants

  • Advanced spectroscopic techniques:

    • Time-resolved fluorescence to measure energy transfer kinetics

    • Electron paramagnetic resonance (EPR) to track specific electron transfer steps

    • Transient absorption spectroscopy to measure PSI reaction center dynamics

  • Correlation analysis between PSAG levels and photosynthetic parameters:

    • Quantitative immunoblotting to determine PSAG protein abundance

    • RNA-seq for transcriptional analysis

    • Integration of protein and transcript data with physiological measurements

  • Comparative analysis across multiple conditions:

    • Standard growth vs. stress conditions

    • Various light intensities and spectra

    • Developmental stages from cotyledon emergence to mature leaves

The experimental design should incorporate elements from studies of other photosystem components, such as the approach used with LCF1 mutants showing that decreased PSII:PSI ratio correlates with higher φPSII . This demonstrates the importance of considering the entire photosynthetic apparatus rather than isolated components.

MeasurementParameterPSAG-specific IndicatorControl/Normalization
P700+ re-reduction kineticst₁/₂ (ms)Electron donation to PSIMeasure with PSI acceptor side inhibitors
Quantum yield of PSIY(I)PSI photochemical efficiencyCompare with Y(II) for PSII
PSI complex assemblyComplex integrity (%)PSAG incorporation efficiencyNormalize to other PSI subunits
State transitionsqTAdaptation to changing lightCompare wild-type vs. PSAG mutants

How does PSAG processing differ between normal development and stress conditions?

The processing of PSAG during chloroplast biogenesis reveals important insights into both normal development and stress responses. Research on photosynthesis-associated proteins indicates that proper translocation, processing, and assembly of these components is crucial for chloroplast biogenesis .

Under normal developmental conditions, PSAG follows a regulated processing pathway:

  • Synthesis in the cytoplasm with a cleavable chloroplast transit peptide

  • Import into the chloroplast through the TOC/TIC machinery

  • Transit peptide cleavage by stromal processing peptidase

  • Integration into the thylakoid membrane and assembly into PSI complexes

Under stress conditions, this process can be significantly altered:

ConditionEffect on PSAG ProcessingMolecular MechanismDetection Method
Light stress (high intensity)Delayed processing, increased intermediatesPhotodamage to processing machineryWestern blot with transit peptide antibodies
Temperature stressMisfolding and aggregationChaperone system overloadDetergent-resistant fraction analysis
Oxidative stressOxidative modifications to transit peptidesRedox-sensitive protease inhibitionMass spectrometry for oxidative modifications
Nutrient limitationPrioritized processing of essential componentsSelective regulation of import machineryComparative proteomics under limiting conditions

Research on conditional photosynthesis mutants var2 and abc1k1 demonstrates that under specific conditions (680 nm red light), these plants accumulate incompletely cleaved processing intermediates of thylakoid proteins . This finding reveals the interdependence between functional photosynthesis and proper protein processing.

To methodologically investigate PSAG processing under stress:

  • Generate specific antibodies against both mature PSAG and its transit peptide

  • Perform pulse-chase experiments to track processing kinetics

  • Use mass spectrometry to identify specific cleavage sites and modifications

  • Compare processing efficiency in wild-type versus stress-sensitivity mutants

This approach provides insights into both fundamental mechanisms of chloroplast biogenesis and potential targets for improving photosynthetic efficiency under adverse conditions.

What techniques best characterize PSAG interactions with other photosystem components?

Characterizing protein-protein interactions involving PSAG requires specialized techniques that preserve the native membrane environment while providing sufficient sensitivity and specificity. A comprehensive approach includes:

  • In vivo crosslinking methodologies:

    • Chemical crosslinking with membrane-permeable reagents

    • Photo-activatable crosslinkers for temporal control

    • Mass spectrometry analysis of crosslinked products

  • Co-immunoprecipitation with specific modifications:

    • Digitonin-solubilized thylakoids to preserve native complexes

    • Antibody specificity verification through knockout controls

    • Sequential immunoprecipitation to identify subcomplex compositions

  • Advanced imaging techniques:

    • Förster Resonance Energy Transfer (FRET) for proximity analysis

    • Bimolecular Fluorescence Complementation (BiFC) for direct interaction visualization

    • Super-resolution microscopy to map spatial distribution

  • Functional interaction assays:

    • Measurement of electron transport rates with specific inhibitors

    • Reconstitution experiments with purified components

    • Domain-swapping experiments to identify interaction interfaces

The specific challenges of working with integral membrane proteins like PSAG require careful optimization of solubilization conditions. Research on photosystem complexes demonstrates that the choice of detergent significantly impacts both the efficiency of extraction and the preservation of native interactions.

Interaction MethodAdvantageLimitationBest Application
Blue native PAGEPreserves native complexesLimited resolution of individual interactionsInitial complex characterization
Yeast two-hybrid membrane systemHigh-throughput screeningArtificial environmentIdentifying potential interactions
Co-immunoprecipitationWorks with endogenous proteinsBackground binding issuesVerification of specific interactions
Crosslinking mass spectrometryIdentifies interaction interfacesComplex data analysisDetailed structural mapping

These approaches have successfully revealed critical interactions in photosystem complexes and can be applied specifically to understand PSAG's role within the PSI architecture.

How can PSAG be leveraged for engineering improved photosynthetic efficiency?

Engineering improved photosynthetic efficiency through PSAG modifications represents an advanced application of photosystem research. The approach draws on insights from natural variants like the LCF1 mutant, which demonstrates enhanced Photosystem II operating efficiency (φPSII) , while applying targeted modifications to PSI components like PSAG.

A methodological framework for this research includes:

Research on the LCF1 mutant provides valuable insights, showing that plants with enhanced photosynthetic efficiency may exhibit reduced growth under normal conditions but can utilize their excess photosynthetic conversion capacity under specific circumstances, such as after dark-induced senescence .

Engineering TargetApproachExpected OutcomeAssessment Method
Electron transfer rateModify residues near electron carriersAccelerated PSI throughputP700+ re-reduction kinetics
Stability under stressIntroduce stabilizing interactionsMaintained function at temperature extremesActivity assays under stress
Optimized PSI:PSII ratioAlter PSAG expression levelsImproved light utilizationChlorophyll fluorescence parameters
Reduced photoprotection requirementModify sites of ROS productionLower energy loss to non-photochemical quenchingNPQ measurements

This research direction represents an advanced application of fundamental knowledge about PSAG structure and function, with potential implications for improving crop productivity under challenging environmental conditions.

How do recent advances in cryo-EM contribute to understanding PSAG structure and function?

Recent advances in cryo-electron microscopy (cryo-EM) have revolutionized structural studies of photosynthetic complexes, providing unprecedented insights into PSAG's structure and interactions within PSI. These technological developments enable:

  • High-resolution structural determination (2-3Å) of intact PSI complexes

  • Visualization of PSAG in its native membrane environment

  • Identification of specific lipid-protein interactions

  • Characterization of conformational changes during electron transfer

The methodological approach for cryo-EM studies of PSAG includes:

  • Optimization of sample preparation to maintain native PSI complexes

  • Collection of thousands of particle images under low-dose conditions

  • Computational processing to generate 3D reconstructions

  • Integration with molecular dynamics simulations for functional insights

Researchers should consider both the advantages and limitations of cryo-EM compared to other structural biology techniques:

Structural TechniqueResolution for PSIAdvantages for PSAG StudiesLimitations
X-ray crystallography2.5-3.5ÅHighest achievable resolutionRequires crystallization, potential artifacts
Cryo-EM2.5-4.0ÅNative lipid environment preservedSample heterogeneity challenges
NMR spectroscopyLocal structure onlyDynamic informationSize limitations, requires isotope labeling
AFMTopographical onlyDirect membrane visualizationSurface information only

What computational models best predict PSAG mutant phenotypes?

Computational modeling approaches provide powerful tools for predicting the phenotypic consequences of PSAG mutations before experimental validation. Based on methodologies used in photosynthesis research, several modeling approaches can be applied:

  • Molecular dynamics simulations:

    • All-atom simulations to predict structural changes

    • Coarse-grained models for longer timescale events

    • Integration of membrane environment effects

  • Quantum mechanical calculations:

    • Density functional theory (DFT) for electron transfer energetics

    • Hybrid QM/MM approaches for active site modeling

    • Correlation of calculated parameters with experimental measurements

  • Machine learning predictive models:

    • Supervised learning algorithms trained on existing mutant data

    • Feature extraction to identify critical sequence determinants

    • Integration of structural and functional data for improved predictions

  • Systems biology models:

    • Flux balance analysis of electron transport networks

    • Integration of transcriptomic and proteomic data

    • Sensitivity analysis to identify critical control points

The development of these models requires high-quality training data, which can be generated through systematic characterization of PSAG variants. Cross-species meta-analysis approaches, as demonstrated for other photosynthetic components , can enhance the predictive power by incorporating data from diverse sources.

Modeling ApproachBest Predictive ApplicationComputational RequirementsValidation Method
Homology modeling + MDStructural stability effectsMedium to highThermal stability assays
Electron transfer kineticsFunctional impacts on PSI efficiencyVery highTime-resolved spectroscopy
Machine learning classifiersPhenotypic category predictionMediumPhenotypic screening
Network modelsSystem-level effectsLow to mediumMulti-omics correlation

By implementing these computational approaches, researchers can prioritize experimental efforts on the most promising PSAG modifications, accelerating progress toward engineering enhanced photosynthetic efficiency.

How does PSAG function integrate with broader chloroplast retrograde signaling?

  • Transcriptomic analysis under PSAG perturbation:

    • RNA-seq of PSAG mutants to identify nuclear response genes

    • Time-course studies following inducible PSAG disruption

    • Integration of transcriptome data with protein abundance measurements

  • Metabolite profiling as potential retrograde signals:

    • Targeted analysis of known retrograde signaling molecules

    • Untargeted metabolomics to identify novel signaling candidates

    • Correlation of metabolite levels with nuclear gene expression changes

  • Genetic interaction studies:

    • Creation of double mutants between PSAG and retrograde signaling components

    • Epistasis analysis to position PSAG in signaling pathways

    • Complementation studies with constitutive retrograde signaling activators

  • Subcellular localization and dynamics:

    • Tracking of signaling components during PSAG dysfunction

    • Analysis of protein translocation between compartments

    • Live-cell imaging of reporter constructs for dynamic responses

Research on conditional photosynthesis mutants (abc1k1 and var2) demonstrates that disruption of photosynthesis can significantly impact chloroplast biogenesis , suggesting a tight coordination between photosynthetic function and developmental processes through retrograde signaling.

Signaling PathwayPotential PSAG ConnectionExperimental ApproachAssessment Method
Tetrapyrrole signalingCoordination with chlorophyll synthesisAnalysis of chlorophyll intermediatesHPLC analysis of tetrapyrroles
ROS signalingElectron transport disruption leading to ROSH₂O₂ and singlet oxygen measurementsFluorescent ROS sensors
Redox signalingAltered stromal redox stateMeasurement of glutathione redox stateRedox-sensitive GFP reporters
Sugar signalingChanged photosynthetic outputAnalysis of sugar levels and signalingSugar-responsive promoter activity

Understanding these integration points provides insights into how plants coordinate nuclear and chloroplast activities to optimize photosynthetic performance under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.