Recombinant Arabidopsis thaliana Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana Photosystem II CP47 Chlorophyll Apoprotein (psbB)

The recombinant Photosystem II CP47 chlorophyll apoprotein (psbB) is a critical photosynthetic protein expressed in thylakoid membranes of chloroplasts. While specific recombinant production details for Arabidopsis thaliana are not directly cited in available literature, homologs from closely related species (e.g., Draba nemorosa) and functional studies in Arabidopsis provide insights into its structure, function, and role in photosynthesis. The protein, encoded by the psbB gene, is a 47 kDa chlorophyll-binding subunit essential for photosystem II (PSII) assembly and electron transport.

Core Function in PSII

The psbB protein is integral to the inner light-harvesting complex (LHCII) of PSII, transferring excitation energy from peripheral antennae to the PSII reaction center (RC) . It stabilizes the PSII core and interacts with CP43 (psbC) to form the PSII monomer .

Assembly and Repair

  • Early Assembly: Required for RC formation and integration of D1/D2 subunits .

  • Photodamage Recovery: Participates in PSII repair cycles, particularly under high light conditions .

Key Mutant Phenotypes:

MutantImpact on psbB/PSIISource
rbd1 (Arabidopsis)Reduced CP47, D1, and D2 accumulation; disrupted PSII supercomplex formation .
fpb1 (Arabidopsis)Accumulation of PSII RC and pre-CP47 intermediates; impaired polysome association with psbB mRNA .

Production Challenges

  • Membrane Integration: Multiple TMDs necessitate specialized E. coli strains or in vitro refolding .

  • Post-Translational Modifications: Phosphorylation and chlorophyll binding are critical for stability .

Research Applications

  • Structural Studies: Recombinant psbB aids in crystallization for X-ray crystallography .

  • Functional Assays: Used to study PSII assembly factors (e.g., RBD1, FPB1) .

RNA Processing and Stability

The psbB gene is part of a pentacistronic operon (psbB-psbT-psbH-petB-petD), requiring intercistronic processing and splicing of group II introns in petB and petD .

Key Regulatory Factors:

FactorFunctionSource
HCF152PPR protein required for splicing petB introns and psbB transcript stability .
SIG3Sigma factor regulating psbN antisense RNA production, which modulates psbT translation .

Future Directions

  • Therapeutic Applications: Potential use in biopharmaceuticals or artificial photosynthetic systems.

  • Agronomic Improvements: Engineering psbB for enhanced photostability in crops.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
psbB; AtCg00680; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47, a core component of photosystem II (PSII), is involved in chlorophyll binding and catalyzing the primary light-induced photochemical processes of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CP47 chlorophyll apoprotein in Photosystem II?

CP47 serves as a core chlorophyll a-binding apoprotein in Photosystem II (PSII), functioning as an integral component of the light-harvesting antenna system. It directly coordinates multiple chlorophyll molecules and facilitates energy transfer from the peripheral antenna to the reaction center. The protein is essential for PSII assembly and structural integrity, with its absence leading to compromised photosynthetic capacity.

Research has shown that CP47 forms part of the core PSII complex alongside PsbA (D1), PsbD (D2), and cytochrome b559. The protein contains six transmembrane helices that anchor it within the thylakoid membrane, with chlorophyll binding occurring after membrane engagement . Importantly, CP47 serves as a reliable marker for PSII complex quantification in biochemical analyses, as it can be easily identified within all PSII complexes .

How is the psbB gene organized within the chloroplast genome of Arabidopsis thaliana?

The psbB gene in Arabidopsis thaliana is part of a polycistronic transcription unit known as the psbB-psbT-psbH-petB-petD operon. This organization represents a classic example of chloroplast gene clustering, where genes encoding components of different thylakoid membrane complexes are co-transcribed.

Within this operon:

  • psbB, psbT, and psbH encode the CP47 apoprotein and the T and H subunits of PSII, respectively

  • petB and petD encode cytochrome b6 and subunit IV of the cytochrome b6f complex

The transcription of this operon generates a pentacistronic RNA precursor that undergoes complex RNA processing events, including intercistronic cleavage and splicing of the petB and petD introns, to produce various mature oligocistronic RNAs . The psbB gene has two different 5' ends, one arising from transcriptional initiation and the other generated by RNA 5' processing .

What experimental approaches are used to study CP47 protein expression and assembly?

Researchers employ several complementary techniques to investigate CP47 expression and assembly into functional PSII complexes:

  • Immunoblot Analysis: Western blotting with specific antibodies against CP47 enables quantification of protein levels under various experimental conditions.

  • Blue Native PAGE (BN-PAGE): Two-dimensional BN-PAGE separates intact photosystem complexes based on size in the first dimension, followed by denaturing PAGE in the second dimension. This technique allows visualization of CP47 distribution among different PSII assemblies (monomers, dimers, and supercomplexes) .

  • Ribosome Profiling: This technique maps ribosome positions on mRNAs, providing insights into translational dynamics of CP47 synthesis and potential pausing sites .

  • Membrane Fractionation: Separation of membrane-bound versus soluble ribosomes allows determination of when nascent CP47 engages the thylakoid membrane during synthesis .

  • Pulse-Chase Labeling: Used to measure CP47 synthesis and stability rates under different experimental conditions .

When quantifying PSII complexes, researchers can determine the fluorescence of Coomassie blue-stained proteins by laser excitation at 700 nm, calculating the relative signal intensities of CP47, which serves as a reliable marker for all PSII complexes .

How does RNA processing affect the expression of the psbB gene in Arabidopsis thaliana?

RNA processing plays a critical role in regulating psbB expression. The nuclear-encoded factor HCF152 has been identified as essential for correct processing of the psbB-psbT-psbH-petB-petD operon transcripts in Arabidopsis.

In hcf152 mutants, the dicistronic psbB-psbT transcripts (1900 and 2000 nucleotides) accumulate to normal levels, but the pattern of oligocistronic petB/D RNAs differs significantly from wild type. Notably:

  • The tricistronic psbH-petB-petD RNA (1800 nucleotides)

  • The dicistronic petB-petD transcript (1500 nucleotides)

  • The monocistronic petB RNA (800 nucleotides)

All these transcripts are substantially reduced in hcf152-1 and hcf152-2 mutants .

Additionally, the fully spliced 4100-nucleotide psbB-psbT-psbH-petB-petD RNA is practically nonexistent in these mutants, replaced by a slightly larger transcript of ~4200 nucleotides that contains psbB, psbT, psbH, and unspliced petB sequences . This altered RNA processing pattern demonstrates the critical role of nucleus-encoded factors in chloroplast gene expression and highlights the complex interplay between nuclear and plastid genomes in regulating photosynthetic protein assembly.

What is the relationship between chlorophyll availability and CP47 apoprotein synthesis and stability?

The relationship between chlorophyll availability and CP47 synthesis/stability has been a subject of scientific debate. The current evidence points to a complex regulatory mechanism with several key findings:

  • Synthesis vs. Stability: While early pulse-labeling studies suggested chlorophyll might activate translation of chlorophyll-binding proteins, more recent research indicates that chlorophyll primarily affects protein stability rather than synthesis rates .

  • Co-translational Binding: The current model suggests that chlorophyll binding occurs co-translationally after the first transmembrane segment engages the thylakoid membrane, as none of the chlorophyll interaction sites is located upstream of the first transmembrane segment .

  • Membrane Engagement: Ribosome footprint analysis in chlorophyll-deficient conditions shows that the position at which nascent CP47 engages the thylakoid membrane is not influenced by chlorophyll deficiency .

  • Proteolytic Regulation: Several thylakoid membrane proteases participate in chlorophyll apoprotein processing and homeostasis, suggesting a proteolytic adjustment of apoprotein levels to chlorophyll availability .

This evidence collectively suggests a model where CP47 synthesis proceeds independently of chlorophyll availability, but the protein is rapidly degraded if chlorophyll binding does not occur, thereby coordinating apoprotein levels with pigment availability.

How does the co-translational membrane engagement of CP47 occur in the thylakoid membrane?

CP47 engages the thylakoid membrane co-translationally through a well-coordinated process:

  • Initial Membrane Engagement: The first transmembrane segment of CP47 serves as the signal that initially engages the membrane .

  • Sequential Integration: Subsequent transmembrane segments are integrated into the membrane as translation proceeds.

  • Chlorophyll Attachment: Terminal chlorophyll synthesis enzymes and carriers are associated with the thylakoid membrane, enabling chlorophyll attachment to the apoprotein only after membrane engagement has initiated .

  • Transmembrane Topology: CP47 contains six transmembrane helices that must be properly inserted to achieve the correct topology for chlorophyll binding and interaction with other PSII components.

Research using ribosome profiling in separated membrane and soluble fractions has shown that the position at which nascent CP47 engages the thylakoid membrane is not influenced by chlorophyll deficiency . This finding suggests that membrane engagement and chlorophyll binding are temporally distinct processes, with membrane engagement occurring independently of pigment availability.

What factors influence PSII supercomplex remodeling and how does CP47 participate in this process?

PSII supercomplex remodeling represents a dynamic response to changing light conditions and is essential for maintaining optimal photosynthetic efficiency. CP47, as a core PSII component, plays a crucial role in this process.

Factors influencing PSII supercomplex remodeling:

FactorEffect on PSII SupercomplexesExperimental Evidence
Light qualityPSI light promotes PSII supercomplex formationQuantification of CP47 distribution showed preferential generation of PSII supercomplexes under PSI light
State transitionsShort-term light quality shifts induce significant remodeling within 30 minutesAnalysis of PSII complexes after PSI-II and PSII-I shifts
STN7 kinase activityEssential for state transitions and associated PSII remodelingQuantification of PSII complexes in stn7 mutants
Photosystem stoichiometryAdjusts primarily by modifying PSI numbers while PSII content remains stableDifferential absorption spectroscopy measurements

CP47 participation in this remodeling process has been characterized using 2D BN-PAGE analysis, where its distribution among different PSII assemblies changes in response to light conditions. Under PSI light, CP47 is found predominantly in larger PSII supercomplexes, while PSII light favors its distribution among smaller complexes .

How do mutations affecting PSII components impact CP47 stability and function?

Mutations affecting various PSII components can have significant consequences for CP47 stability and function, revealing important insights into the interdependence of PSII subunits.

A particularly instructive example comes from studies of PsbQ-deficient Arabidopsis plants. Although these plants appear visually normal under standard growth conditions, they exhibit dramatic phenotypes under low light:

  • Progressive chlorosis: Mutant plants yellow after 2 weeks of low light exposure and eventually die after 3-4 weeks .

  • CP47 loss: A large loss of several PSII components, including CP47, is observed under low light conditions .

  • Altered electron transfer: Analysis of QA- decay kinetics reveals defects in electron transfer from QA- to QB .

  • Photosynthetic efficiency decline: Significant alterations in fluorescence characteristics include increased F0 and decreased FV, resulting in reduced PSII quantum efficiency (FV/FM) .

These findings demonstrate that although PsbQ appears dispensable under optimal conditions, it becomes critical for maintaining PSII stability, including CP47 retention, under light-limited conditions. This reveals the conditional nature of certain PSII component interactions and highlights the importance of examining mutant phenotypes under varying environmental conditions.

What are the optimal protocols for isolating functional recombinant CP47 from Arabidopsis thaliana?

Isolating functional recombinant CP47 requires a careful approach that preserves protein structure and function. While no single "optimal" protocol exists, several methodological considerations are critical:

  • Expression System Selection: When expressing recombinant CP47, chloroplast transformation of Arabidopsis or Chlamydomonas is preferred over bacterial systems to ensure proper folding and co-factor integration.

  • Affinity Tag Placement: N-terminal tags are generally preferred over C-terminal tags, as the C-terminus may be involved in critical interactions with other PSII components.

  • Membrane Solubilization: Begin with mild detergents (β-DDM or digitonin) at low concentrations to maintain protein-protein interactions within the PSII complex.

  • Purification Strategy: Two-step purification combining affinity chromatography followed by size exclusion chromatography yields the highest purity while preserving function.

  • Quality Control Metrics: Functional CP47 should display characteristic absorbance spectra (peaks at 436 and 675 nm), appropriate oligomeric state in native PAGE, and the ability to bind chlorophyll molecules.

The effectiveness of CP47 isolation can be assessed through Western blotting using specific antibodies against CP47, verifying its size (~47 kDa) and presence in the membrane fraction. For functional studies, researchers should verify chlorophyll binding by measuring absorbance spectra before and after purification.

How can researchers differentiate between translation defects and protein stability issues when studying CP47 mutants?

Distinguishing between translation defects and stability issues represents a significant methodological challenge in CP47 research. Effective experimental strategies include:

  • Ribosome Profiling: This technique provides a direct measure of translation by capturing ribosome-protected mRNA fragments, allowing researchers to quantify ribosome occupancy on the psbB transcript . Decreased ribosome footprints along the entire transcript suggest translation initiation defects, while localized changes may indicate elongation issues.

  • Polysome Association Analysis: Examining the association of psbB mRNAs with polysomes through sucrose gradient fractionation can reveal translation efficiency independently of protein stability.

  • Pulse-Chase Experiments: By labeling newly synthesized proteins with radioactive amino acids for a brief period (pulse) followed by incubation with non-radioactive amino acids (chase), researchers can track protein synthesis versus degradation rates .

  • Inhibitor Studies: Using translation inhibitors (like lincomycin) versus protease inhibitors helps differentiate primary defects in synthesis from secondary effects on stability.

  • in vitro Translation: Cell-free chloroplast translation systems allow direct assessment of psbB transcript translation efficiency in controlled conditions.

The technical challenge of discriminating lack of protein synthesis from rapid protein turnover in pulse-labeling assays has historically complicated interpretations . Modern approaches combining multiple techniques provide more definitive results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.