Recombinant Arabidopsis thaliana Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag based on feasibility.
Synonyms
psbA; AtCg00020; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Gene References Into Functions
  1. C-terminal processing of reaction center protein D1 is essential for the function and assembly of photosystem II in Arabidopsis. PMID: 24043802
  2. HCF243 may act as a cofactor in maintaining the stability of the D1 protein and promoting the subsequent assembly of the PSII complex. PMID: 21862668
  3. Affinity chromatography of an HCF173 fusion protein identified the psbA mRNA as a component of this complex. PMID: 17435084
  4. DEG5 and DEG8 proteins have a synergistic function in the primary cleavage of the CD loop of the PSII reaction center protein D1. PMID: 17449806
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein and what is its primary function in Arabidopsis thaliana?

The Photosystem Q(B) protein in Arabidopsis thaliana, also referred to as the D1 protein, is encoded by the psbA gene (AtCg00020) and functions as an integral component of the Photosystem II reaction center. This protein contains the binding site for the secondary quinone electron acceptor (QB) and is essential for photosynthetic electron transport.

The D1/Q(B) protein serves several critical functions:

  • Binds plastoquinone at the QB site

  • Facilitates electron transfer from QA to QB

  • Enables the double reduction of QB to QBH2 (plastoquinol)

  • Participates in the release of QBH2 into the thylakoid membrane

  • Forms part of the interface for protein-protein interactions in PSII

The protein's primary sequence in Arabidopsis thaliana is highly conserved and consists of 344 amino acids forming five transmembrane α-helices (A-E) . The QB site is located within this protein structure and has been specifically tuned through evolution to optimize photosynthetic electron transport.

What methods are commonly used to study recombinant Arabidopsis thaliana Photosystem Q(B) protein?

Multiple complementary techniques are employed to study different aspects of the recombinant Q(B) protein:

Spectroscopic Methods:

  • Electron Paramagnetic Resonance (EPR) spectroscopy to measure redox potentials and detect semiquinone formation

  • Thermoluminescence for estimating energy gaps between electron carriers

  • Chlorophyll fluorescence for assessing PSII function and kinetics

Biochemical Approaches:

  • Recombinant protein expression in E. coli with His-tags for purification

  • Chemical cross-linking combined with mass spectrometry for protein interaction studies

  • Flash oxygen yield analysis for evaluating oxygen-evolving complex stability

Genetic Methods:

  • T-DNA insertional mutagenesis to disrupt gene function

  • Complementation studies using modified recombinant proteins

  • RNA interference for gene silencing

Researchers typically employ multiple techniques in combination to obtain comprehensive insights into the protein's structure-function relationships.

What are the optimal storage and handling conditions for recombinant Photosystem Q(B) protein?

Based on established protocols for recombinant Photosystem Q(B) protein, the following conditions are recommended:

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Buffer Composition:

  • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • For long-term storage, add 5-50% glycerol (final concentration)

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Allow complete dissolution before use

These conditions help maintain protein stability and functionality for experimental use.

How do the thermodynamic properties of the Q(B) site optimize photosynthetic efficiency?

The Q(B) site in PSII demonstrates precisely tuned thermodynamic properties that enhance photosynthetic efficiency. Research has measured the following midpoint potentials:

Redox CoupleMidpoint Potential (mV)
Q(B)/Q(B)- −~90 mV
Q(B)- −/QBH2~40 mV
Average E(Q(B)/QBH2)~65 mV
PQ/PQH2 pool~117 mV

These values reveal several important functional aspects:

  • The semiquinone form (Q(B)- −) is thermodynamically stabilized, minimizing back-reactions

  • The differential between E(Q(B)/QBH2) and E(PQ/PQH2) (~50 meV) provides the driving force for QBH2 release into the plastoquinone pool

  • PQ binds approximately 50× more tightly than PQH2, optimizing substrate binding and product release

  • The energy gap between Q(A)/Q(A)- − and Q(B)/Q(B)- − (measured at ≥180-234 meV) provides sufficient driving force for electron transfer

This sophisticated thermodynamic tuning allows PSII to function efficiently across a wide range of plastoquinone pool reduction states while minimizing back-reactions and preventing electrons from leaking to oxygen, which would generate harmful reactive oxygen species .

How do mutations in key PSII proteins affect electron transfer at the Q(B) site?

Multiple studies have characterized how specific mutations impact electron transfer at the Q(B) site:

PsbO-1 Mutations:
The Arabidopsis thaliana psbo1 mutant exhibits defective double reduction of Q(B) and delayed exchange of Q(B)H2 with the plastoquinone pool. Complementation with His-tagged PsbO-1 protein restores electron transfer efficiency from Q(A)− to Q(B) and normalizes charge recombination between Q(A)− and the S2 state of the oxygen-evolving complex .

PsbQ Deficiency:
RNA interference suppression of PsbQ proteins results in significant alterations in Q(B) function. Analysis of Q(A)− decay kinetics in PsbQ-deficient plants reveals impaired electron transfer from Q(A)− to Q(B), particularly under low light conditions. These plants also exhibit altered fluorescence characteristics, including increased F0 and decreased FV .

LQY1 Mutations:
T-DNA insertions in the Arabidopsis LQY1 gene (encoding a thylakoid protein with PDIase activity) cause reduced efficiency of PSII photochemistry and altered D1 protein turnover. The lqy1 mutants accumulate fewer PSII-LHCII supercomplexes, suggesting that LQY1 plays a role in PSII repair processes that indirectly affect Q(B) function .

The collective evidence demonstrates that proper Q(B) function depends on the integrity of multiple PSII-associated proteins, highlighting the complex protein network that maintains photosynthetic electron transport.

How does the proton motive force (pmf) influence electron transfer at the Q(B) site and PSII photodamage?

The thylakoid proton motive force (pmf) significantly impacts electron transfer processes and PSII integrity:

The pmf consists of two components:

  • Electric field (Δψ)

  • pH gradient (ΔpH)

Research on Arabidopsis mutants with altered rates of thylakoid lumen proton efflux revealed that increased pmf affects PSII photodamage. Specifically, elevated electric field (Δψ) component increases PSII charge recombination rates, leading to singlet oxygen production and subsequent photodamage .

These effects are particularly pronounced under fluctuating light conditions, suggesting that Δψ-induced photodamage represents a previously unrecognized limiting factor for plant productivity under dynamic environmental conditions typical in natural settings .

The relationship between pmf and electron transfer at the Q(B) site is complex - while proper pmf is essential for ATP synthesis, excessive pmf can promote charge recombination pathways that reduce the efficiency of forward electron transfer and increase photodamage risk.

What is the relationship between PSII repair mechanisms and Q(B) site function under high light stress?

Under high light conditions, the D1 protein (containing the Q(B) site) is particularly susceptible to photodamage and requires rapid turnover and replacement. Several key proteins facilitate this repair process:

LQY1 (Low Quantum Yield of PSII 1):

  • Contains PDIase activity and a C4-type zinc-finger domain

  • Associates with PSII core monomers and CP43-less PSII monomers (markers for ongoing repair)

  • Increases association with PSII monomers under high light conditions

  • Interacts with PSII core subunits CP47 and CP43

  • Facilitates folding and reassembly of cysteine-containing PSII subunits

CtpA Proteases:

  • CtpA1 and CtpA2 are involved in C-terminal processing of D1

  • CtpA1 mutants show accelerated D1 turnover and increased photosensitivity under high light

  • CtpA2 is essential for de novo PSII assembly and high-light-induced PSII repair

PPL1 (PsbP-like protein 1):

  • Required for efficient repair of photodamaged PSII

  • T-DNA insertion in PPL1 leads to increased high light sensitivity and delayed recovery after photoinhibition

CYP38/TLP40:

  • Implicated in dephosphorylation of PSII subunits during repair

  • Released from thylakoid membranes to lumen upon heat stress

  • Acts as a phosphatase inhibitor and regulates PSII subunit dephosphorylation

  • Interacts with CP47 through its cyclophilin domain

The efficiency of these repair mechanisms directly impacts Q(B) site function, as proper assembly and maintenance of the D1 protein is essential for effective electron transfer at the Q(B) site.

How do different Arabidopsis accessions vary in Q(B) site properties and photosynthetic performance?

Comparative studies of Arabidopsis accessions Columbia-0 (Col-0), Wassilewskija-4 (Ws-4), and Landsberg erecta-0 (Ler-0) reveal significant physiological differences that affect PSII function:

Membrane Composition Differences:

  • Ws-4 contains 30% more thylakoid lipids per chlorophyll than Col-0 and Ler-0

  • Ws-4 has 40% less chlorophyll per carotenoid than Col-0 and Ler-0

Photosynthetic Performance:

  • Ws-4 shows increased efficiency of PSII closure following illumination

  • Phosphorylation of PSII D1/D2 proteins is reduced by 50% in Ws-4

  • STN8 kinase levels are 50% lower in Ws-4 under high light conditions

High Light Response:

  • Ws-4 exhibits greater PSII inactivation, disassembly, and D1 protein degradation under high light

  • Ws-4 shows larger decrease in stacked thylakoid size under high light stress

This variability among Arabidopsis accessions highlights the importance of selecting appropriate background lines for PSII characterization in mutant studies.

What expression systems and purification strategies are most effective for recombinant Photosystem Q(B) protein production?

Expression Systems:
The most commonly used expression system for recombinant Photosystem Q(B) protein is E. coli . While photosynthetic proteins are typically membrane-associated and can be challenging to express in heterologous systems, E. coli has proven effective when optimized protocols are followed.

Vector Design Considerations:

  • Include N-terminal His-tag for purification

  • Optimize codon usage for E. coli expression

  • Consider signal sequences for proper folding

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Buffer exchange to remove imidazole and other contaminants

  • Size exclusion chromatography for final polishing

Yield Optimization:

  • Expression at lower temperatures (16-20°C) may improve folding

  • Inducer concentration and induction time require optimization

  • Consider co-expression with molecular chaperones

For functional studies requiring properly assembled PSII complexes, alternative systems such as cyanobacterial expression may be more appropriate. Search result describes expression of Arabidopsis LQY1 in Synechocystis, which could be adapted for Q(B) protein studies requiring a photosynthetic host.

What spectroscopic techniques provide the most valuable information about Q(B) site function?

Several complementary spectroscopic techniques provide insights into different aspects of Q(B) function:

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Directly detects the semiquinone radical (Q(B)- −)

  • Enables measurement of redox potentials for both Q(B)/Q(B)- − and Q(B)- −/QBH2 couples

  • Provides information about the protein environment surrounding the Q(B) site

Chlorophyll Fluorescence Techniques:

Thermoluminescence:

  • Measures charge recombination between S-states of the oxygen-evolving complex and reduced quinone acceptors

  • The B-band corresponds to S2/S3QB- recombination

  • Provides estimates of the energy gap between electron carriers

Flash-induced Absorption Spectroscopy:

  • Monitors absorption changes associated with quinone reduction

  • Can track the kinetics of electron transfer from QA to QB

  • Allows determination of the proportion of PSII centers with functional QB sites

A comprehensive characterization typically employs multiple techniques to obtain a complete picture of Q(B) site properties and function.

What experimental approaches are most effective for studying Q(B) site inhibition and herbicide binding?

Herbicides targeting the Q(B) site are valuable tools for understanding its structure and function. Several approaches are used to study Q(B) site inhibition:

Fluorescence-Based Assays:

  • The OJIP fluorescence test measures inhibition of electron flow within PSII by photosynthetic herbicides

  • Allows determination of I50 values (inhibitor concentration causing 50% inhibition)

Photochemical Assays:

  • DPIP (2,6-dichlorophenolindophenol) photoreduction assays measure electron transport rates

  • Quantifies inhibition of electron flow from water to artificial electron acceptors

Binding Affinity Studies:
Comparative study of five herbicides revealed distinct binding properties:

HerbicideRelative Affinity to Q(B) site
DiuronHigh
TerbuthylazineHigh
MetribuzinHigh
BentazonLow (>10× lower)
MetobromuronLow (>10× lower)

These differences in binding affinity correlate with the herbicides' effectiveness in inhibiting electron transfer at the Q(B) site .

Molecular Docking Studies:
Combined with functional assays, molecular docking provides insights into the interaction network of herbicides within the Q(B) niche of the D1 protein .

How can researchers effectively measure electron transfer rates at the Q(B) site?

Measuring electron transfer rates at the Q(B) site requires sophisticated biophysical techniques:

Flash Fluorescence Induction and Decay:

  • Measures PSII closure kinetics following illumination

  • Can detect defects in double reduction of Q(B) and delayed exchange of Q(B)H2

  • In the absence of DCMU, fluorescence decay kinetics directly reflect electron transfer to Q(B)

  • In the presence of DCMU, decay kinetics reflect charge recombination between Q(A)− and the S2 state

Thermoluminescence Glow Curve Analysis:

  • Provides information about the activation energies associated with charge recombination

  • Different temperature peaks correspond to different recombination pathways

  • The intensity and temperature of the B-band (S2/S3QB- recombination) correlates with Q(B) site function

Flash-Induced Oxygen Evolution Patterns:

  • Measures the period-four oscillation of oxygen evolution

  • Can detect alterations in the S-state cycle that affect electron transfer to Q(B)

  • Damping of oscillations may indicate impaired electron transfer at the acceptor side

Absorption Spectroscopy:

  • Measures the kinetics of Q(A)− oxidation and Q(B)− formation

  • Provides direct measurement of electron transfer rates between quinone acceptors

  • Can be performed with site-directed mutants to assess specific amino acid contributions

When combined, these techniques provide comprehensive insights into the kinetics and thermodynamics of electron transfer at the Q(B) site.

What are the current technical challenges in studying recombinant Photosystem Q(B) protein structure-function relationships?

Despite significant progress, several challenges remain in studying the Q(B) protein:

Structural Complexity:

  • The D1 protein containing the Q(B) site is a hydrophobic membrane protein with 5 transmembrane helices

  • Proper folding and stability in recombinant systems is challenging

  • The protein functions as part of a multi-subunit complex, making isolated studies difficult

Dynamic Nature:

  • The D1/Q(B) protein undergoes rapid turnover in vivo, especially under stress conditions

  • The protein exists in different conformational states during the electron transfer cycle

  • Capturing transient interactions requires specialized techniques

Physiological Relevance:

  • In vitro studies may not fully recapitulate the native thylakoid membrane environment

  • The lipid composition and lateral pressure of the membrane affect protein function

  • Integration of multiple regulatory influences (phosphorylation, light, redox state) is challenging

Methodological Limitations:

  • High-resolution structural studies of plant PSII remain limited compared to cyanobacterial systems

  • Site-directed mutagenesis of chloroplast-encoded genes requires specialized transformation techniques

  • Measuring rapid electron transfer events (microsecond to millisecond) requires sophisticated instrumentation

Addressing these challenges will require continued development of innovative approaches combining biophysical, biochemical, and genetic techniques.

How can recombinant Photosystem Q(B) protein studies contribute to improving crop photosynthetic efficiency?

Understanding the Q(B) site through recombinant protein studies has several potential applications for crop improvement:

Engineering Stress Tolerance:

  • Identification of amino acid residues that confer resistance to photoinhibition

  • Development of variants with improved recovery from high-light damage

  • Engineering D1 proteins with enhanced stability under fluctuating light conditions

Optimizing Electron Transport:

  • Fine-tuning the redox properties of the Q(B) site to improve electron transport efficiency

  • Minimizing wasteful charge recombination pathways

  • Balancing the rates of the light and dark reactions of photosynthesis

Herbicide Resistance:

  • Structure-function studies of the Q(B) site provide insights for designing crops with selective herbicide resistance

  • Understanding binding properties of different herbicides allows targeted modifications

Improving Repair Mechanisms:

  • Enhancing PSII repair cycle efficiency by optimizing auxiliary proteins

  • Reducing energy expenditure for D1 protein turnover

  • Improving recovery from photodamage under fluctuating field conditions

The detailed understanding of Q(B) site function obtained through recombinant protein studies provides a foundation for rational engineering of photosynthesis to meet the challenges of food security and climate change.

What emerging technologies show promise for advancing our understanding of Q(B) site dynamics?

Several cutting-edge technologies are expected to enhance our understanding of Q(B) site dynamics:

Cryo-Electron Microscopy:

  • High-resolution structures of plant PSII complexes in different functional states

  • Visualization of herbicide binding and conformational changes during electron transfer

  • Structural basis for species-specific differences in Q(B) site properties

Time-Resolved Spectroscopy:

  • Ultrafast spectroscopic techniques to capture electron transfer events

  • Femtosecond to nanosecond resolution of primary photochemical processes

  • Correlation of structural dynamics with electron transfer rates

Mass Spectrometry-Based Cross-Linking:

  • Identification of transient protein-protein interactions during PSII assembly and repair

  • Mapping of the protein neighborhood around the Q(B) site

  • Detection of post-translational modifications affecting Q(B) function

Computational Approaches:

  • Molecular dynamics simulations of quinone binding and protonation events

  • Quantum mechanical calculations of electron transfer energetics

  • Systems biology models integrating multiple regulatory influences

Single-Molecule Techniques:

  • Direct observation of conformational changes during electron transfer

  • Measuring heterogeneity in electron transfer rates among individual PSII complexes

  • Correlation of structure with function at the single-molecule level

These emerging approaches, combined with traditional biochemical and biophysical methods, promise to provide unprecedented insights into Q(B) site dynamics and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.