Recombinant Arabidopsis thaliana Potassium channel KAT1 (KAT1)

Shipped with Ice Packs
In Stock

Description

Introduction to KAT1

KAT1 (Potassium channel KAT1) is an inward-rectifying potassium (K⁺) channel from Arabidopsis thaliana, a model organism in plant biology. It belongs to the Shaker family of voltage-gated K⁺ channels and plays a critical role in stomatal regulation, K⁺ uptake, and cellular membrane potential maintenance . The recombinant form of KAT1 is engineered for expression in heterologous systems (e.g., E. coli), enabling detailed structural, functional, and regulatory studies .

Functional Roles

KAT1 mediates inward K⁺ currents under hyperpolarized membrane potentials, contributing to:

  • Stomatal Closure: Regulated by ABA (abscisic acid) and Ca²⁺ signaling pathways .

  • K⁺ Uptake: Cooperates with transporters like HAK5 in roots under low K⁺ conditions .

  • Cellular pH Regulation: Modulated by cytosolic pH and 14-3-3 protein interactions .

Regulation and Modulation

KAT1 activity is tightly controlled by post-translational modifications and protein interactions:

Phosphorylation-Dependent Regulation

SiteKinaseEffectSource
Thr306SnRK2.6 (ABA-activated)Reduces K⁺ influx; critical for stomatal closure.
Thr308SnRK2.6Minimal functional impact.

Protein Interactions

  • AtKC1: Forms heteromers with KAT1, shifting activation thresholds and preventing K⁺ efflux under low external K⁺ .

  • 14-3-3 Proteins: Enhance channel activity in a dose-dependent manner .

Research Applications

The recombinant KAT1 is employed in:

  1. Electrophysiology: Patch-clamp studies in Xenopus oocytes and insect cells to analyze voltage gating and ion selectivity .

  2. Structural Biology: Cryo-EM studies to resolve conformational changes during activation/inhibition .

  3. Phosphorylation Mapping: LC-MS/MS identification of Thr306/Thr308 phosphorylation sites .

  4. Protein Interaction Studies: Co-expression with AtKC1 to probe regulatory mechanisms .

Key Research Findings

  1. Orientation in Membrane: KAT1 shares structural homology with Shaker channels but retains inward-rectifying properties due to conserved voltage-sensing mechanisms .

  2. ABA Signaling: SnRK2.6-mediated phosphorylation of Thr306 is essential for KAT1’s role in stomatal closure during drought stress .

  3. Heteromerization: AtKC1 inhibits KAT1 activity by altering pore stability and activation thresholds, preventing K⁺ efflux under low external K⁺ .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
KAT1; At5g46240; MPL12.2; Potassium channel KAT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-677
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KAT1
Target Protein Sequence
MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYR AWEMWLVLLVIYSAWICPFQFAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSY LLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGSELGFRILSMLRLWRLRRVSS LFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVV HWTSRTRTFRDSVRAASEFASRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIR SSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPPKEDIILQNEAPTDLYILVSG AVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH AHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRKDGYGLDVTN PTSDTALMDAIHKEDTEMVKKILKEQKIERAKVERSSSETAGRSYANDSSKKDPYCSSSN QIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLASEKFGGCNFTKITNADNAEI DDLDVIWDGDHLYFSSN
Uniprot No.

Target Background

Function
KAT1 is a highly selective inward-rectifying potassium channel. This voltage-gated channel mediates long-term potassium influx into guard cells, leading to stomatal opening. It transitions between open and closed conformations in response to voltage differences across the membrane, with activation occurring upon hyperpolarization. The channel's activity is enhanced by external acidification. It is also permeable to ammonium ions and is blocked by tetraethylammonium and barium ions.
Gene References Into Functions
  1. Data reveal that in KAT-type K(+) channel KAT1, residue K85 within the linker forms a hydrogen bond with C211, facilitating pH activation. PMID: 26846460
  2. Plant stress metabolite acrolein inhibits light-induced stomatal opening by inhibiting KAT1 potassium channels in Arabidopsis thaliana. PMID: 25144495
  3. Mutations of the central Phe residue favored the closed KAT1 channel, while mutations affecting the countercharge centers favored the open channel PMID: 25185120
  4. Instead of single key amino acids, several titratable residues contribute to the pH-sensor of the plant Kin channel KAT1 PMID: 22070190
  5. Trafficking of KAT1 has been shown to depend on ER export signals PMID: 20712625
  6. Results suggest that a kinase analogous to protein kinase C might exist in plant cells, potentially modulating KAT1 channel activity through calcium-dependent phosphorylation at specific residues in the cytosolic region of KAT1. PMID: 20423459
  7. Phosphatidylinositol phosphates have been identified as essential regulators for both the voltage-dependent and -independent activation of A. thaliana potassium channels, including KAT1, expressed in X. laevis oocytes. PMID: 15842627
  8. KAT1 was expressed in mammalian HEK293 cells and analyzed using patch clamp technology in the whole cell configuration. The data demonstrate that depletion of extracellular potassium results in a decrease in channel conductance. PMID: 16263909
  9. This study provided evidence that the trafficking of plant plasma membrane ion channels is controlled by a conserved mechanism. PMID: 16950859
  10. Structure prediction for the down state of the Kat1 voltage sensor PMID: 17187053
  11. The study reports that abscisic acid, a hormone controlling ion transport and transpiration in plants under water stress, triggers the selective endocytosis of the KAT1 K+ channel protein in epidermal and guard cells. PMID: 17683934
  12. The combined use of selected detergents facilitated the effective purification of functional KAT1 through affinity and gel-filtration chromatography. PMID: 18638455

Show More

Hide All

Database Links

KEGG: ath:AT5G46240

STRING: 3702.AT5G46240.1

UniGene: At.305

Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in guard cells, and in roots.

Q&A

What is the molecular structure of KAT1 and how does it compare to other potassium channels?

KAT1 is a 78-kDa protein that belongs to the Shaker superfamily of potassium channels. Despite functioning as an inward-rectifying channel, KAT1 shares significant structural features with outward-rectifying K+ channels. The protein contains a cluster of six putative membrane-spanning helices (S1-S6) at the amino terminus, similar to animal Shaker channels . This structural conservation between plant and animal K+ channels suggests evolutionary preservation of a fundamental transport mechanism.

The channel features a positively charged S4 segment that serves as a voltage sensor, containing characteristic Arg/Lys-Xaa-Xaa-Arg/Lys repeats . Another defining structural element is the highly conserved pore-forming region (known as H5 or SS1-SS2) containing the TXGYGD signature sequence that is critical for K+ selectivity and conduction . Detailed structural studies using epitope tagging have confirmed that despite its inward-rectifying properties, KAT1 maintains membrane orientation similar to that of Shaker K+ channels, with both N and C termini facing the cytoplasmic side .

How does KAT1 function as an inward-rectifying potassium channel in plant cells?

KAT1 functions primarily as an inward-rectifying K+ channel that facilitates potassium uptake into cells when activated by membrane hyperpolarization. Unlike outward rectifiers, KAT1 opens when the membrane potential becomes more negative than its activation threshold, allowing K+ ions to flow into the cell . This property is particularly important in guard cells, where KAT1 plays a central role in stomatal opening by mediating K+ uptake.

The channel is additionally regulated by pH, with extracellular acidification causing a positive shift in its activation potential . This pH sensitivity represents an important regulatory mechanism allowing plants to modulate K+ uptake in response to changing environmental conditions.

What experimental evidence confirms KAT1's orientation in the plasma membrane?

The orientation of KAT1 in the plasma membrane was definitively established through elegant epitope tagging experiments. To resolve whether inward rectification might result from a reversed membrane orientation compared to outward rectifiers, researchers inserted flag epitopes at specific locations in the protein structure. Flag tags were strategically placed in the NH2 terminus and the S3-S4 loop of the channel .

Immunofluorescence studies using antibodies against both the flag epitope and the C-terminal region of KAT1 determined the localization of these epitopes relative to the membrane. Results conclusively demonstrated that KAT1 maintains the same orientation as Shaker K+ channels, with both N and C termini facing the cytoplasmic side of the membrane . This finding was significant because it established that KAT1's inward-rectifying properties could not be explained by a reversed membrane orientation.

Instead, the channel's distinctive rectification characteristics arise from intrinsic gating mechanisms rather than a flipped topology. The tagged constructs expressed functional channels with electrophysiological properties similar to those of the wild-type channel, confirming that the epitope insertions did not disrupt channel function .

What expression systems are most effective for studying recombinant KAT1?

Multiple heterologous expression systems have proven effective for functional studies of recombinant KAT1, each offering distinct advantages for different research questions. Three primary systems have been successfully employed:

Xenopus laevis oocytes: This system has been particularly valuable for electrophysiological characterization of KAT1. Oocytes efficiently express functional channels that can be readily assessed using two-electrode voltage clamp or patch-clamp techniques. The large size of oocytes facilitates manipulation and recording, making this system ideal for detailed biophysical studies and structure-function analyses .

Saccharomyces cerevisiae (yeast): The K+ uptake-deficient yeast strain CY162, which lacks endogenous potassium transporters TRK1 and TRK2, has proven invaluable for functional complementation studies. When expressed in CY162, KAT1 rescues growth under K+-limited conditions, providing a powerful screening system for channel functionality . This approach has been particularly useful for identifying functional regions through chimeric channel constructions and mutagenesis studies.

Mammalian cell lines (COS-7): KAT1 can be functionally expressed in mammalian cells such as COS-7, making them suitable for studying channel localization, trafficking, and regulation in a eukaryotic context . This system is particularly valuable for immunolocalization studies and for investigating interactions with regulatory proteins.

The choice between these systems depends on specific experimental objectives. Yeast complementation provides a straightforward functional readout, while electrophysiological recordings in oocytes or mammalian cells offer detailed insights into channel kinetics and biophysical properties.

How can researchers generate functional KAT1-based chimeric channels for structure-function studies?

Creating chimeric channels between KAT1 and other K+ channels represents a powerful approach for identifying regions responsible for specific functional properties. The method has been successfully employed to pinpoint domains that contribute to KAT1's ability to complement K+ uptake-deficient yeast. A systematic approach involves:

  • Selection of complementary channel partners: Choosing channel partners with distinct functional properties, such as KAT1 and AKT2, provides a clear phenotypic differentiation . While KAT1 complements growth of K+-uptake deficient yeast, AKT2 does not, making this pair ideal for domain mapping studies.

  • Strategic junction point selection: Junction points for chimera construction should be based on predicted secondary structure elements and domain boundaries to minimize disruption of protein folding. Successful chimeras have been generated by exchanging entire domains or specific segments between channels .

  • Construction methodology: Chimeras can be generated using overlap extension PCR or restriction enzyme-based cloning techniques. The recombinant constructs should be sequenced to confirm correct fusion points and absence of unintended mutations.

  • Functional validation: Expression in K+-uptake deficient yeast (strain CY162) provides a straightforward assay for channel functionality. Growth on K+-limited medium identifies constructs that retain KAT1's functional properties .

In a systematic study comparing KAT1 and AKT2, researchers generated 12 chimeric constructs with different junction points. Only 3 chimeras (C-4, C-6, and C-12) fully rescued yeast growth under K+-limited conditions, with one additional chimera (C-7) showing slight growth in liquid culture . This approach successfully identified the transmembrane core region, particularly the voltage-sensor domain and pore region, as critical for KAT1's functional activity in yeast.

What electrophysiological techniques are most suitable for characterizing KAT1 channel properties?

Several electrophysiological techniques have been optimized for characterizing KAT1 channel properties, each providing unique insights into channel function:

Two-electrode voltage clamp (TEVC): This technique is particularly suitable for recordings from Xenopus oocytes expressing KAT1. TEVC allows measurement of whole-cell currents and characterization of basic channel properties including voltage dependence of activation, ion selectivity, and modulation by external factors such as pH and blocking agents . The technique is relatively simple to implement and provides robust data on macroscopic channel behavior.

Patch-clamp recordings: Both whole-cell and single-channel patch-clamp configurations have been successfully applied to KAT1 studies. These approaches provide higher resolution data on channel gating kinetics, conductance properties, and single-channel behavior. Patch-clamp has been particularly valuable for recording from plant guard cell protoplasts expressing native or modified KAT1 channels .

Heterologous expression systems: For detailed electrophysiological characterization, KAT1 has been recorded in various expression systems:

  • Xenopus oocytes provide a robust system for examining channel biophysical properties

  • Mammalian cells such as COS-7 offer a eukaryotic environment with sophisticated protein processing

  • Native KAT1 currents can be measured in guard cell protoplasts, though these contain multiple channel types

Key parameters to measure include:

  • Activation threshold and voltage dependence

  • Time course of activation and deactivation

  • Current-voltage relationships

  • Ion selectivity using ion substitution protocols

  • Sensitivity to blockers (tetraethylammonium, Ba²⁺)

  • pH dependence of channel activity

  • Effect of dominant negative mutations on current amplitude

These electrophysiological approaches, combined with molecular techniques such as site-directed mutagenesis, have provided comprehensive insights into KAT1 function and regulation.

How can dominant negative KAT1 mutants be used to study guard cell function and water regulation in plants?

Dissecting physiological roles of K⁺ channels: Transgenic expression of dominant negative KAT1 mutants (particularly those with point mutations T256R and G262K in the pore region) has successfully reduced inward K⁺ currents in guard cell protoplasts . This approach directly links molecular channel function to whole-plant physiology, demonstrating that K⁺ channels are essential for normal stomatal movement.

Quantifying impacts on water relations: Plants expressing dominant negative KAT1 mutants show reduced transpirational water loss from leaves, directly connecting K⁺ channel function to whole-plant water regulation . This approach provides a more specific manipulation than pharmacological blockers, which may affect multiple channel types.

Methodological approach: The experimental protocol involves:

  • Generating transgenic plants expressing the dominant negative KAT1 mutant under appropriate promoters

  • Validating expression using Northern blot or RT-PCR analysis

  • Isolating guard cell protoplasts for patch-clamp analysis of K⁺ inward currents

  • Measuring stomatal apertures in epidermal peels

  • Assessing whole-plant transpiration rates

This approach has conclusively demonstrated that guard cell K⁺ channels are essential for normal stomatal function and plant water regulation, providing a direct link between molecular channel properties and whole-plant physiology.

What regions of KAT1 are responsible for its ability to complement K⁺ uptake-deficient yeast, and how was this determined?

The regions of KAT1 responsible for its ability to complement K⁺ uptake-deficient yeast have been systematically mapped using chimeric channel constructs. Unlike AKT2, KAT1 can rescue growth of the K⁺ uptake-defective Saccharomyces cerevisiae mutant strain CY162 in K⁺-limited media, providing a clear functional assay . This difference in complementation ability served as the foundation for a comprehensive structure-function analysis.

Experimental approach:
Researchers constructed 12 KAT1-AKT2 chimeric channels with various junction points, expressing them in the yeast strain CY162 . Growth complementation tests were performed in K⁺-limited medium, with results assessed both on solid medium and in liquid culture. This systematic approach revealed:

Key findings:

  • Only three chimeras (C-4, C-6, and C-12) fully rescued yeast growth under K⁺-limited conditions

  • One additional chimera (C-7) showed slight growth in liquid culture

  • All other chimeras failed to confer growth ability in low K⁺ medium

Critical regions identified:
Based on the pattern of functional complementation, the transmembrane core region of KAT1 was identified as essential for its activity in S. cerevisiae . This functional domain encompasses not only the pore region but also parts of the voltage-sensor domain. The pore region alone was insufficient to confer complementation ability, indicating that multiple structural elements work together to determine channel function in the yeast system.

This methodical chimeric approach demonstrates how structure-function relationships can be systematically mapped even without high-resolution structural data, providing insights into the molecular determinants of channel function in different cellular contexts.

How can the AMPRIL (Arabidopsis Multiparent RIL) population be leveraged to study natural variation in KAT1 function?

The Arabidopsis Multiparent Recombinant Inbred Line (AMPRIL) population represents an innovative resource for exploring natural allelic variation in genes like KAT1. This population consists of a set of six connected four-way crosses obtained from eight diverse founder Arabidopsis thaliana accessions . This genetic resource enables several powerful approaches for studying KAT1 variation:

Advantages of the AMPRIL population for KAT1 studies:

  • Enhanced genetic diversity: The population captures allelic diversity from eight geographically diverse accessions (Col, Kyo-1, Cvi, Sha, Eri-1, An-1, Ler, and C24) , potentially encompassing functional KAT1 variants adapted to different environments.

  • Increased mapping resolution: The multiparent design provides higher recombination density than traditional biparental populations, enabling fine mapping of quantitative trait loci (QTLs) affecting KAT1-mediated processes.

  • Residual heterozygosity utilization: Since RILs were genotyped in the F4 generation and phenotyped in the F5 generation, residual heterozygosity can be exploited to confirm and fine-map QTLs in regions containing KAT1 .

Methodological approach for KAT1 studies:

  • Phenotyping strategy: Measure traits influenced by K⁺ channel activity, such as:

    • Stomatal conductance

    • Drought tolerance

    • K⁺ accumulation in tissues

    • Guard cell K⁺ currents (in selected lines)

  • QTL analysis: Apply mixed-model methodology allowing tests for:

    • QTL main effects

    • QTL by background interactions

    • QTL by QTL interactions

  • Candidate gene confirmation: For QTLs co-localizing with KAT1, sequence the gene in founder accessions to identify polymorphisms, then use residual heterozygosity in segregating lines to confirm causal relationships.

The AMPRIL population has already demonstrated its value by detecting QTLs explaining as little as 1.6% of genotypic variation for flowering time . This sensitivity suggests it could effectively capture subtle functional variations in KAT1 that might adapt plants to different potassium availability or environmental stresses across diverse habitats.

How does KAT1 structurally and functionally compare to animal Shaker family potassium channels?

Despite functioning as an inward-rectifying channel, KAT1 shares remarkable structural homology with animal Shaker family K⁺ channels, which typically function as outward rectifiers. This evolutionary conservation provides important insights into fundamental channel architecture:

Structural similarities:

  • Transmembrane topology: Like animal Shaker channels, KAT1 contains six transmembrane segments (S1-S6) , with both N and C termini located on the cytoplasmic side of the membrane .

  • Voltage-sensing domain: KAT1 contains a positively charged S4 segment with characteristic Arg/Lys-Xaa-Xaa-Arg/Lys repeats that functions as a voltage sensor , similar to the voltage-sensing mechanism in animal channels.

  • Pore structure: KAT1 contains the highly conserved pore region (H5 or SS1-SS2) with the signature TXGYGD sequence that determines K⁺ selectivity , a feature preserved across eukaryotic K⁺ channels.

Functional differences:

  • Rectification properties: The most striking difference is rectification direction. Animal Shaker channels typically activate with depolarization (outward rectifiers), while KAT1 activates with hyperpolarization (inward rectifier) . This functional difference occurs despite similar structural organization.

  • Voltage-sensing mechanism: Despite containing a similar voltage-sensing domain, KAT1 responds to voltage changes in an opposite manner compared to animal Shaker channels. This functional inversion is not due to reversed membrane orientation , suggesting fundamental differences in the coupling between voltage sensing and gate opening.

  • Modulation: KAT1 is strongly modulated by extracellular acidification, which shifts its activation potential in a positive direction , a regulatory mechanism particularly relevant to plant physiology.

These comparative analyses demonstrate that plants and animals have preserved the basic structural blueprint for voltage-gated K⁺ channels while evolving distinct gating mechanisms and regulatory properties suited to their respective physiological contexts. This conservation suggests that the fundamental channel architecture arose early in eukaryotic evolution, before the divergence of plants and animals.

What distinguishes KAT1 from AKT2 in terms of structural features and functional properties?

KAT1 and AKT2 are both plant potassium channels from Arabidopsis thaliana, but they exhibit distinct functional properties that can be attributed to specific structural differences. Comparative studies using chimeric channels have illuminated these distinctions:

Functional differences:

  • Complementation ability: KAT1 complements the growth of K⁺ uptake-defective Saccharomyces cerevisiae mutant strain CY162 in K⁺-limited medium, while AKT2 does not . This provides a clear functional distinction for structure-function studies.

  • Rectification properties: KAT1 functions primarily as an inward-rectifying channel, while AKT2 displays weak rectification properties and can function in both inward and outward modes depending on regulatory conditions .

  • Expression patterns: KAT1 is preferentially expressed in guard cells where it regulates stomatal movements , while AKT2 is predominantly expressed in phloem tissues and plays roles in long-distance K⁺ transport.

Structural determinants of functional differences:
Chimeric channel studies have identified specific regions responsible for these functional distinctions:

  • Transmembrane core region: The transmembrane core of KAT1 is critical for its activity in S. cerevisiae . This includes not only the pore region but also parts of the voltage-sensor domain.

  • Channel gating: Differences in the coupling between voltage sensing and channel opening likely account for the different rectification properties of these channels.

  • Regulatory domains: Variations in cytoplasmic regulatory domains contribute to different responses to cellular signals and regulatory factors.

When 12 KAT1-AKT2 chimeras were tested for complementation of yeast growth, only three chimeras (C-4, C-6, and C-12) fully rescued growth under K⁺-limited conditions . This systematic analysis demonstrates that multiple regions of the channel contribute to functional differences, and that both the pore and voltage-sensing domains play critical roles in determining channel function in cellular contexts.

What is the phylogenetic relationship between KAT1 and other Arabidopsis potassium channels?

The Arabidopsis thaliana genome encodes 15 K⁺-selective channels that are subdivided into three structural classes based on phylogenetic analysis . KAT1 belongs to a distinct clade within this family, and understanding these relationships provides insight into evolutionary specialization of plant K⁺ channels:

Phylogenetic classification of Arabidopsis K⁺ channels:

  • Shaker-like channels: This group includes KAT1 and related channels characterized by six transmembrane domains and a single pore region. Within this class, channels are further subdivided based on functional properties and sequence homology :

    • Inward rectifiers: KAT1, KAT2, AKT1, AKT5, AKT6

    • Weak/modulated rectifiers: AKT2

    • Outward rectifiers: GORK, SKOR

    • Silent regulatory subunits: AtKC1

  • TPK/KCO family: Two-pore K⁺ channels with four transmembrane domains and two pore regions

  • Kir-like channels: Channels with structural similarities to animal inward rectifiers

Evolutionary implications:
The phylogenetic organization suggests that different classes of plant K⁺ channels evolved to fulfill specialized physiological roles. KAT1 and related inward rectifiers adapted to mediate K⁺ uptake in contexts such as guard cells, while outward rectifiers evolved to facilitate K⁺ efflux in processes like stomatal closure.

The closest homologs to KAT1 include KAT2 from Arabidopsis and KST1 from Solanum tuberosum (potato), which shares significant functional and structural similarity . These channels likely arose from gene duplication events, followed by specialization for tissue-specific functions.

The distribution of K⁺ channel types across plant tissues reflects their specialized roles: KAT1 and KAT2 are predominantly expressed in guard cells, AKT1 in roots, and AKT2 in phloem tissues . This tissue-specific distribution underscores how evolutionary diversification of the channel family enabled specialized K⁺ transport mechanisms adapted to different cellular contexts.

Which specific mutations in the pore region of KAT1 generate dominant negative phenotypes, and how do they affect channel function?

Key dominant negative mutations:

  • T256R mutation: This threonine-to-arginine substitution in the pore region significantly disrupts channel function .

  • G262K mutation: This glycine-to-lysine substitution also generates a strong dominant negative effect .

Both mutations are located in the highly conserved pore region, specifically targeting the signature sequence that defines K⁺ selectivity. These substitutions introduce positively charged amino acids (arginine or lysine) into positions normally occupied by neutral residues, likely disrupting both ion conduction and subunit assembly.

Functional impacts on channel properties:

  • Suppression of current: When co-expressed with wild-type KAT1 in Xenopus oocytes, these dominant negative subunits dramatically reduce inward K⁺ currents .

  • Heteromultimeric assembly: These mutant subunits can assemble not only with wild-type KAT1 but also with other K⁺ channel subunits like AKT2, indicating their ability to form heteromultimeric channels in vivo .

  • Physiological effects: Transgenic Arabidopsis plants expressing dominant negative KAT1 mutants show reduced K⁺ inward currents in guard cell protoplasts, impaired stomatal opening, decreased K⁺ uptake, and reduced transpirational water loss from leaves . This demonstrates a direct link between molecular channel function and whole-plant physiology.

The selective nature of these effects is highlighted by recent findings suggesting that plant K⁺ channels do not indiscriminately form heteromultimers, indicating that non-physiological multimers are less likely to form in vivo with dominant negative KAT1 mutants . This specificity enhances the value of these mutants as tools for dissecting channel function in complex physiological contexts.

How does extracellular pH affect KAT1 channel activity and what is the molecular mechanism?

KAT1 channel activity is significantly modulated by extracellular pH, a regulatory mechanism with important implications for plant physiological responses. Detailed electrophysiological studies have characterized this pH sensitivity and begun to elucidate its molecular basis:

Effect of extracellular pH on channel properties:

  • Activation potential shift: Both KAT1 and its potato homolog KST1 are activated upon extracellular acidification through a positive-going shift in their activation potential . This means that as the external medium becomes more acidic, the channels activate at less negative membrane potentials.

  • Physiological relevance: This pH sensitivity allows plants to modulate K⁺ uptake in response to changing environmental conditions, particularly in contexts like guard cell function where apoplastic pH can fluctuate.

Molecular mechanisms of pH sensing:
The molecular basis for pH sensitivity likely involves protonation of specific amino acid residues that alter the electrostatic environment of the voltage sensor or the channel pore. Potential pH-sensing mechanisms include:

  • Voltage sensor modulation: Protonation of acidic amino acids near the voltage-sensing domain (S4) could alter the local electric field experienced by the voltage sensor, shifting its response to membrane potential.

  • Pore region effects: Protonation of residues near the channel pore might directly affect ion conduction or the coupling between voltage sensing and pore opening.

  • Allosteric effects: pH changes could induce conformational changes in extracellular domains that allosterically modify channel gating.

Detailed structure-function studies, including site-directed mutagenesis of candidate pH-sensing residues, have been employed to identify the molecular determinants of pH sensitivity. These studies suggest that multiple residues contribute to the pH response, consistent with complex allosteric mechanisms rather than a single pH sensor.

The pH modulation of KAT1 represents an important regulatory mechanism that allows plants to adapt K⁺ transport to changing environmental conditions, highlighting the sophisticated control mechanisms that have evolved to optimize ion channel function in plant cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.