Recombinant Arabidopsis thaliana Potassium channel KAT3 (KAT3)
Shipped with Ice Packs 
In Stock 
Description
Functional Role in Potassium Transport
Mechanistic Insights:
-
KAT3 downregulates AKT1 and KAT1 by forming heterotetramers, altering their voltage dependence and ion selectivity .
-
Essential for root potassium uptake under low-K⁺ conditions, as shown in Atkc1 knockout mutants with impaired growth .
Electrophysiological Properties:
| Parameter | Value/Outcome | Reference |
|---|---|---|
| Voltage dependence | Modulates AKT1 rectification | |
| Ion selectivity | Enhances K⁺ over Na⁺ selectivity | |
| pH sensitivity | Stable across physiological pH |
Research Applications and Findings
Biotechnological Use:
-
Recombinant KAT3 is used to generate polyclonal antibodies for immunolocalization studies .
-
Facilitates structural studies via MALDI-TOF/TOF analysis, confirming peptide sequences (e.g., LPADATLRDVVMVVR) .
Key Studies:
-
Heteromerization with AKT1 (Honsbein et al., 2009):
-
Stress Response (Rocchetti et al., 2012):
Table 1: Comparative Analysis of KAT3 Homologs
| Species | Homolog | Function | Reference |
|---|---|---|---|
| Oryza sativa | OsKAT3 | Root K⁺ uptake | |
| Brassica oleracea | BoKAT3 | Drought resilience |
Challenges and Future Directions
-
Expression Limitations: Low native expression levels necessitate recombinant systems for bulk production .
-
Structural Resolution: Full 3D structure remains unresolved, hindering mechanistic studies .
-
Agricultural Potential: Engineering KAT3-kinase fusions (e.g., CIPK23) could enhance crop K⁺ efficiency under stress .
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Before opening the vial, we recommend brief centrifugation to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KAT3; AKT4; KC1; At4g32650; F4D11.150; Potassium channel KAT3; AtKC1; Potassium channel TKC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-662
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KAT3
Target Protein Sequence
MSTTTTEARSPLPLLLRRGRSSTALSASTAEARSPLSILQFRRRSSKDVRNITSVSSSLL
PAFGTFIEDDNPSSKPFIVLHFDRRYRLWELFLVILVGYSAWASLFELAFEKAAEGALLT
IDLVVDFFFAVDIILTFFVSYLDNTTYLNVTDHKLIAKRYLKSVAFVMDVASTLPIQFIY
KTITGDVGRGQAFGFLNLLRLWRLRRVAELFKRLEKDAHFNYFVIRVIKLLCVTIFWIHL
AGCILYWIAYHYPRPTDTWIGSQVEDFKERSVWLGYTYSMYWSIVTLTTVGYGDLHAVNS
REKTFNMFYMLFNIGLTSYIIGIMTNLVVHGALRTFAMRSAINDILRYTSKNRLPDTMRE
QMLAHMQLKFKTAELRQEEVLQDLPKAIRSSINQHLFRSIIEEAYLFKGFPEGLLVQLVS
QIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIASKGVSEQVLAKLGPGSMAGEIGVVF
NIPQPFTVRTRRLSQVIRIGHHKFKEMVQSDNDVDAKMIIANFMTYLKGLNDELKKEIPF
LRDLLDDADAQVQETVQSEETPQSNDEEIVTVSRHENGQIEERRREGVPKRVIIHGQAPP
NQDNKNNGDSNGRLIILPDSIQLLFDLAEKKLGKRGSTIAMADGAHVEQIDALRENDHLY
IF
Uniprot No.
Target Background
Function
KAT3 is a probable modulatory (alpha) subunit of inward-rectifying potassium channels. It may play a role in potassium uptake from the soil solution by plant roots in association with AKT1.
Gene References Into Functions
- AtKC1-mediated channel activity regulation is essential for normal plant growth. PMID: 21518051
- The interaction between SYP121 and KC1 enhances K+ channel gating, activates K+ channel current, and promotes K+ uptake. PMID: 19794113
Database Links
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in root hairs and root endodermis and, at a lower level, in leaf nodes, trichomes, and hydathodes.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
