Recombinant Arabidopsis thaliana PRA1 family protein B2 (PRA1B2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRA1B2; At2g40380; T3G21.15; PRA1 family protein B2; AtPRA1.B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1B2
Target Protein Sequence
MSSSPAILPVTNQQAATQSQPPINSHAFRTFLSRLSSSLRESLSQRRPWLELVDRSSFAR PDSLTDSFSRIRKNLAYFKVNYSAIVSLVLAFSLLSHPFSLLVLLSLLGSWMFLYLFRSS DQPLVLFGRSFSDRETLLGLVLTTIVVVFMTSVGSLLTSALTIGIAIVCLHGAFRVPDDL FLDEQEPANAGLLSFIGNSAATSAAASVVAGRV
Uniprot No.

Target Background

Function
PRA1B2 may be involved in both secretory and endocytic intracellular trafficking within the endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT2G40380

STRING: 3702.AT2G40380.1

UniGene: At.28021

Protein Families
PRA1 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is the PRA1 gene family in Arabidopsis thaliana?

The PRA1 (Prenylated Rab Acceptor 1) gene family in Arabidopsis thaliana encodes small transmembrane proteins that regulate vesicle trafficking as receptors of Rab GTPases and the vacuolar soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein VAMP2 . Sequence analysis has revealed that higher plants, including Arabidopsis, possess an expanded family of PRA1 domain-containing proteins compared to animals and primitive plants . Arabidopsis contains 19 PRA1 family members (AtPRA1) with protein sizes ranging from 180 to 240 amino acid residues and predicted molecular masses between 20-27 kDa .

The AtPRA1 proteins can be phylogenetically classified into several clades (A-G), with PRA1B2 belonging to clade B. This classification correlates with their interaction patterns, as members of the same clade typically share similar interaction profiles .

What is the functional significance of PRA1B2 in vesicle trafficking?

PRA1B2, as a member of clade B of the AtPRA1 family, functions predominantly in the vesicle trafficking pathway. Based on interaction studies, PRA1B2 interacts with other PRA1 family members in clade B and the single member of clade E . This suggests that PRA1B2 forms part of a protein complex that regulates specific vesicle trafficking events.

Like other PRA1 family members, PRA1B2 likely modulates the activity of Rab GTPases, which are key regulators of vesicle formation, movement, and fusion. The interaction between PRA1 proteins and Rab GTPases enables the coordinated control of vesicle docking and fusion events in plant cells . Additionally, AtPRA1 genes are significantly coexpressed with Rab GTPases and genes encoding vesicle transport proteins, further supporting their role in vesicle trafficking processes .

What experimental approaches can be used to study PRA1B2 subcellular localization?

To study the subcellular localization of PRA1B2, multiple complementary approaches should be employed:

  • Fluorescent protein fusion: Generate N- or C-terminal fusions of PRA1B2 with fluorescent proteins (GFP, YFP, or mCherry) and express them in Arabidopsis protoplasts or stable transgenic plants.

  • Confocal microscopy: Use confocal laser scanning microscopy to visualize the fluorescently tagged PRA1B2 in living cells, along with established organelle markers to determine colocalization patterns.

  • Immunogold electron microscopy: For higher resolution localization, use specific antibodies against PRA1B2 coupled with gold particles for visualization under electron microscopy.

  • Subcellular fractionation: Isolate different cellular compartments and detect PRA1B2 using Western blotting to confirm microscopy findings.

Research on the PRA1 family indicates that different members localize to distinct compartments including the endoplasmic reticulum, Golgi apparatus, and endosomes/prevacuolar compartments . Based on the clade-specific localization patterns, PRA1B2 is likely to be predominantly associated with the Golgi apparatus and endosomal compartments.

What are the expression patterns of PRA1B2 in different Arabidopsis tissues?

AtPRA1 gene family members, including PRA1B2, display distinct expression patterns with a preference for vascular cells and expanding or developing tissues . While specific data for PRA1B2 expression must be experimentally determined for each research context, the general expression pattern of the PRA1 family in 8-day-old seedlings shows expression in vascular, expanding, or developing tissues .

To analyze PRA1B2 expression in your specific experimental system, consider utilizing the Expression Atlas database, which contains over 1,014 plant experiments studying Arabidopsis and other plant species . This resource provides both baseline expression data (RNA-seq or proteomics) under normal conditions and differential expression data showing regulation under various experimental conditions.

Tissue TypeRelative PRA1B2 ExpressionPrimary Detection Method
Vascular tissueHighRNA-seq, qRT-PCR
Expanding tissuesModerate to highRNA-seq, qRT-PCR
Developing organsModerate to highRNA-seq, qRT-PCR
Mature leavesLow to moderateRNA-seq, qRT-PCR
RootsVariable (depending on zone)RNA-seq, qRT-PCR

How can I quantitatively analyze PRA1B2 expression in response to stress?

To analyze PRA1B2 expression in response to stress, implement the following methodological approach:

  • Experimental design:

    • Subject Arabidopsis plants to stress treatments (e.g., ER stress, drought, salt, pathogen infection)

    • Collect tissue samples at multiple time points (0, 1, 3, 6, 12, 24, 48 hours)

    • Include appropriate biological replicates (minimum n=3)

  • RNA extraction and quality assessment:

    • Extract total RNA using TRIzol or column-based methods

    • Assess RNA quality using spectrophotometry (A260/A280 ratio) and gel electrophoresis

    • Perform DNase treatment to remove genomic DNA contamination

  • Quantitative RT-PCR:

    • Design gene-specific primers for PRA1B2 with amplicon size 80-150 bp

    • Include multiple reference genes (e.g., ACTIN2, UBQ10, EF1α) for normalization

    • Use a relative quantification method (2^-ΔΔCT) to calculate fold changes

  • RNA-seq analysis:

    • For global expression analysis, prepare RNA-seq libraries

    • Sequence using an appropriate platform (Illumina, PacBio)

    • Analyze using standardized pipelines like iRAP, as mentioned in the Expression Atlas methodology

    • Compare PRA1B2 expression with other genes involved in vesicle trafficking

  • Validation with reporter lines:

    • Generate transgenic Arabidopsis lines with PRA1B2 promoter:GUS or PRA1B2 promoter:LUC fusions

    • Analyze reporter activity in response to the same stress treatments

The Unfolded Protein Response (UPR) pathway, which is activated by ER stress, may be particularly relevant for PRA1B2 expression analysis since this retrograde signaling pathway contributes to development, reproduction, immunity, and abiotic stress tolerance in plants .

What expression systems are optimal for producing recombinant Arabidopsis PRA1B2?

The optimal expression system for recombinant PRA1B2 production depends on your experimental needs. Based on the characteristics of membrane proteins like PRA1B2, consider these approaches:

  • Bacterial expression system (E. coli):

    • Advantages: High yield, cost-effective, rapid growth

    • Recommended strains: BL21(DE3), Rosetta 2(DE3), or C41(DE3) for membrane proteins

    • Expression vector: pET series with N-terminal His-tag for purification

    • Induction conditions: 0.1-0.5 mM IPTG at 16-18°C for 16-20 hours to minimize inclusion body formation

    • Limitations: May encounter issues with proper folding and post-translational modifications

  • Yeast expression system (Pichia pastoris):

    • Advantages: Eukaryotic processing, higher likelihood of correct folding

    • Recommended strain: X-33 or KM71H

    • Expression vector: pPICZ series with methanol-inducible promoter

    • Induction conditions: 0.5% methanol, 25-30°C for 2-4 days

    • Limitations: Longer production time compared to bacteria

  • Plant-based expression systems:

    • Advantages: Native cellular environment, proper folding and modifications

    • Options: Transient expression in Nicotiana benthamiana or stable expression in Arabidopsis cell culture

    • Expression vector: pCAMBIA series with 35S promoter

    • Limitations: Lower yields, more labor-intensive

The choice of expression system should be guided by the intended application of the recombinant protein. For structural studies requiring large amounts of protein, E. coli or P. pastoris systems may be preferable. For functional studies requiring properly folded protein with native modifications, plant-based systems might be more appropriate despite lower yields.

What purification strategies yield high purity recombinant PRA1B2?

Purifying recombinant PRA1B2, a membrane-associated protein, requires specialized approaches:

  • Membrane protein extraction:

    • Disrupt cells via sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, and protease inhibitors

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize membrane proteins using detergent screening (test n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at 0.5-2%)

  • Affinity chromatography:

    • For His-tagged PRA1B2, use Ni-NTA resin equilibrated with extraction buffer containing the optimal detergent

    • Apply sample and wash with increasing imidazole concentrations (10-40 mM)

    • Elute protein with higher imidazole concentration (250-300 mM)

  • Size exclusion chromatography:

    • Further purify the protein using a Superdex 200 column

    • Running buffer: 25 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent at 2× CMC

    • Collect fractions and analyze by SDS-PAGE

  • Quality assessment:

    • Analyze purity by SDS-PAGE and Western blotting

    • Confirm protein identity by mass spectrometry

    • Assess protein folding using circular dichroism spectroscopy

A similar approach has been successfully used for the purification of recombinant human proteins as described in the R&D Systems protocol, which includes affinity purification followed by activity assessment .

How can the activity of recombinant PRA1B2 be assessed in vitro?

Assessing the activity of recombinant PRA1B2 requires experimental approaches that evaluate its ability to interact with Rab GTPases and influence vesicle trafficking:

  • Rab GTPase binding assay:

    • Express and purify recombinant Rab GTPases (particularly those co-expressed with PRA1B2)

    • Perform pull-down assays using immobilized PRA1B2-His and Rab proteins

    • Alternatively, use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding parameters (Kd, ΔH, ΔS)

  • Liposome association assay:

    • Prepare liposomes with phospholipid composition mimicking Golgi or endosomal membranes

    • Incubate recombinant PRA1B2 with liposomes

    • Separate liposome-bound and free protein by centrifugation

    • Analyze protein distribution by Western blotting

  • In vitro vesicle budding assay:

    • Isolate Golgi membranes from Arabidopsis

    • Add recombinant PRA1B2, cytosol, and ATP regenerating system

    • Analyze vesicle formation by electron microscopy or biochemical fractionation

  • Homodimerization and heterodimerization assays:

    • Use chemical crosslinking or analytical ultracentrifugation to assess oligomerization state

    • For heterodimerization, test interactions with other purified PRA1 family members, particularly those in clade B that show interaction in yeast two-hybrid assays

Assay TypeKey ReagentsExpected Results for Active PRA1B2
Rab GTPase bindingPurified Rab proteins, GTP/GDPPreferential binding to specific Rab GTPases in GTP-bound form
Liposome associationLiposomes of defined compositionAssociation with liposomes containing specific phospholipids
Vesicle buddingIsolated Golgi membranes, ATPEnhanced vesicle formation compared to control
DimerizationCrosslinking reagentsFormation of dimers/oligomers at physiological concentrations

How can I identify novel protein interaction partners of PRA1B2?

To identify novel protein interaction partners of PRA1B2, employ multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged PRA1B2 (GS-tag or TAP-tag) in Arabidopsis cell culture or plants

    • Purify protein complexes under native conditions

    • Identify co-purified proteins by mass spectrometry

    • This approach was successfully used to characterize the RNA polymerase II transcript elongation complex

  • Yeast two-hybrid screening:

    • Use PRA1B2 as bait to screen an Arabidopsis cDNA library

    • Confirm interactions by reverse yeast two-hybrid

    • Perform quantitative β-galactosidase assays to assess interaction strength

    • Filter out false positives through subsequent validation

    • The PRA1 family has been previously characterized using yeast two-hybrid to identify homodimerization and heterodimerization patterns

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse PRA1B2 and candidate interactors with complementary fragments of YFP

    • Co-express in protoplasts or plants

    • Visualize interaction by confocal microscopy

    • Verify subcellular localization of the interaction

  • Proximity-dependent biotin identification (BioID):

    • Fuse PRA1B2 with a biotin ligase (BirA*)

    • Express in plant cells and add biotin

    • Purify biotinylated proteins and identify by mass spectrometry

    • This method captures transient and weak interactions

Based on the known interaction network of PRA1 family proteins, PRA1B2 is expected to interact with:

  • Other PRA1 family members, particularly those in clade B

  • The single member of PRA1 clade E

  • Specific Rab GTPases involved in vesicle trafficking between the ER, Golgi, and endosomes

  • Components of SNARE complexes involved in vesicle fusion

What methods are best for validating the interaction between PRA1B2 and Rab GTPases?

To validate interactions between PRA1B2 and Rab GTPases, a multi-tiered approach is recommended:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged PRA1B2 and Rab GTPases in plant cells

    • Immunoprecipitate one protein and detect the presence of the other by Western blotting

    • Include controls with non-interacting proteins and GTPase mutants (constitutively active and dominant negative forms)

    • Test interaction dependence on nucleotide state (GDP vs. GTP)

  • Pull-down assays with recombinant proteins:

    • Express and purify His-tagged PRA1B2 and GST-tagged Rab GTPases

    • Perform reciprocal pull-down assays

    • Analyze protein complexes by SDS-PAGE and Western blotting

    • Test dependency on nucleotide state by preloading Rab GTPases with GDP or non-hydrolyzable GTP analogs

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions (e.g., PRA1B2-CFP and Rab-YFP)

    • Express in plant cells and measure FRET efficiency

    • Perform acceptor photobleaching to confirm FRET signals

    • Use appropriate controls to account for bleed-through

  • Split-luciferase complementation assay:

    • Fuse PRA1B2 and Rab GTPases to complementary fragments of luciferase

    • Co-express in plant cells and measure luminescence

    • Quantify interaction strength through luminescence intensity

Since PRA1 proteins function as receptors for Rab GTPases , it is critical to determine which specific Rab GTPases interact with PRA1B2 and under what conditions these interactions occur. Based on the coexpression data of AtPRA1 genes with Rab GTPases , you should prioritize testing interactions with Rab GTPases involved in ER-to-Golgi and endosomal trafficking.

What approaches can be used to study the function of PRA1B2 in Arabidopsis?

To elucidate the function of PRA1B2 in Arabidopsis, implement these complementary approaches:

  • Loss-of-function analysis:

    • Generate CRISPR/Cas9 knockout lines targeting PRA1B2

    • Obtain T-DNA insertion mutants from stock centers if available

    • Create RNAi lines for conditional knockdown

    • Validate gene disruption or silencing by RT-PCR and Western blotting

    • Phenotype plants under various growth conditions and stresses

  • Gain-of-function analysis:

    • Generate overexpression lines using the 35S promoter or an inducible system

    • Create tissue-specific overexpression using appropriate promoters

    • Validate increased expression by qRT-PCR and Western blotting

    • Analyze phenotypic changes compared to wild-type plants

  • Subcellular trafficking analysis:

    • Investigate changes in protein transport using fluorescent cargo proteins

    • Analyze distribution of organelle markers in mutant backgrounds

    • Perform FM4-64 uptake assays to examine endocytic trafficking

    • Use Brefeldin A treatment to assess Golgi-to-ER trafficking

  • Electron microscopy:

    • Examine ultrastructural changes in cellular organelles

    • Look for accumulation of vesicles or abnormal organelle morphology

    • Perform immunogold labeling to track specific proteins

  • Interactome analysis in mutant backgrounds:

    • Compare protein interaction networks between wild-type and pra1b2 mutants

    • Identify compensatory mechanisms involving other PRA1 family members

Given that different PRA1 family members have distinct expression patterns with preferences for vascular cells and developing tissues , phenotypic analysis should focus on these tissues and developmental stages where PRA1B2 is most highly expressed.

How does PRA1B2 function relate to the Unfolded Protein Response in Arabidopsis?

The relationship between PRA1B2 and the Unfolded Protein Response (UPR) can be investigated through these experimental approaches:

  • Expression analysis under ER stress:

    • Treat Arabidopsis with UPR inducers (tunicamycin, DTT, or thapsigargin)

    • Monitor PRA1B2 expression changes by qRT-PCR and Western blotting

    • Compare with known UPR marker genes (BiP, PDI, CNX)

    • Analyze expression in UPR-defective mutants (ire1a/ire1b, bzip17, bzip28)

  • Phenotypic characterization of pra1b2 mutants under ER stress:

    • Grow pra1b2 knockout/knockdown plants on media containing UPR inducers

    • Compare sensitivity with wild-type and known UPR mutants

    • Measure growth parameters (root length, fresh weight, survival rate)

    • Analyze cellular markers of ER stress (ER morphology, chaperone levels)

  • Protein trafficking during UPR:

    • Monitor movement of fluorescently tagged secretory and membrane proteins

    • Compare trafficking efficiency between wild-type and pra1b2 mutants under ER stress

    • Analyze colocalization with UPR-induced compartments (e.g., ER-derived bodies)

  • Interaction with UPR components:

    • Test for interactions between PRA1B2 and UPR sensors/effectors

    • Analyze localization changes of PRA1B2 during UPR activation

    • Investigate potential roles in ERAD (ER-associated degradation) machinery

The Unfolded Protein Response is a conserved ER-to-nucleus signaling pathway that contributes to development, reproduction, immunity, and abiotic stress tolerance in plants . As PRA1B2 is involved in vesicle trafficking and is likely localized to the ER-Golgi interface, it may play a role in modulating protein transport during ER stress conditions.

How can I analyze the role of PRA1B2 in plant immunity and stress responses?

To investigate PRA1B2's role in plant immunity and stress responses, implement this systematic approach:

  • Pathogen response assays:

    • Challenge pra1b2 mutants and overexpression lines with bacterial (Pseudomonas), fungal (Botrytis), and oomycete (Phytophthora) pathogens

    • Quantify pathogen growth, disease symptoms, and cell death

    • Measure defense hormone levels (salicylic acid, jasmonic acid)

    • Analyze expression of defense marker genes

  • Abiotic stress response:

    • Expose plants to drought, salt, heat, and cold stresses

    • Measure physiological parameters (relative water content, electrolyte leakage, chlorophyll fluorescence)

    • Assess survival rates and recovery after stress

    • Quantify stress-responsive metabolites

  • Secretory pathway analysis during stress:

    • Track movement of defense-related secreted proteins (PR1, defensins)

    • Analyze secretion of antimicrobial compounds

    • Examine callose deposition and cell wall reinforcements

    • Monitor trafficking of pattern recognition receptors (FLS2, EFR)

  • Hormone response assays:

    • Treat plants with defense hormones (SA, JA, ethylene)

    • Analyze growth responses and gene expression changes

    • Compare with known hormone signaling mutants

  • Molecular interaction with immunity components:

    • Test for interactions with vesicle trafficking components involved in immunity

    • Analyze colocalization with defense-related compartments (e.g., papillae)

    • Investigate interactions with Rab GTPases known to function in immunity

Since vesicle trafficking plays a crucial role in plant immunity through the secretion of antimicrobial compounds and the delivery of receptors to the plasma membrane, PRA1B2 may be involved in these processes. Additionally, the UPR pathway, which may involve PRA1B2, contributes to immunity in plants , further suggesting a potential role for PRA1B2 in defense responses.

What are the emerging techniques for studying PRA1B2 dynamics in live cells?

Advanced techniques for studying PRA1B2 dynamics in live cells include:

  • Super-resolution microscopy:

    • Employ PALM, STORM, or STED microscopy to visualize PRA1B2 localization beyond the diffraction limit

    • Track single molecules of fluorescently tagged PRA1B2

    • Analyze nanoscale organization within membrane compartments

    • Recommended setup: TIRF-PALM for membrane-associated regions

  • Optogenetic manipulation:

    • Fuse PRA1B2 with photosensitive domains (CRY2, PhyB, LOV)

    • Induce protein clustering, activation, or inactivation with specific wavelengths of light

    • Monitor vesicle trafficking changes in real-time following manipulation

    • Control with spatiotemporal precision to target specific cellular regions

  • CRISPR imaging:

    • Utilize dCas9 fused to fluorescent proteins to label endogenous PRA1B2 gene loci

    • Track gene position and dynamics during transcriptional activation

    • Combine with RNA FISH to correlate gene position with expression

  • Live-cell proteomics:

    • Employ proximity labeling techniques like TurboID with faster kinetics

    • Use APEX2 for spatiotemporally controlled protein labeling

    • Combine with Raman microscopy for label-free detection of protein dynamics

  • Correlative light and electron microscopy (CLEM):

    • Visualize fluorescently tagged PRA1B2 by light microscopy

    • Process the same sample for electron microscopy

    • Obtain ultrastructural context for PRA1B2 localization

    • Combine with electron tomography for 3D reconstruction

  • Fluorescence correlation spectroscopy (FCS):

    • Measure diffusion coefficients of PRA1B2 in different membrane compartments

    • Determine concentration and oligomerization state in situ

    • Analyze protein-protein interactions through fluorescence cross-correlation spectroscopy (FCCS)

These techniques provide unprecedented resolution and quantitative insights into protein dynamics, enabling researchers to understand the spatial and temporal regulation of PRA1B2 in its native cellular environment.

How can computational approaches enhance our understanding of PRA1B2 function?

Computational approaches can significantly advance our understanding of PRA1B2 function through these methodologies:

  • Structural prediction and modeling:

    • Use AlphaFold2 or RoseTTAFold to predict PRA1B2 structure

    • Perform molecular dynamics simulations to analyze membrane integration

    • Model homodimer and heterodimer structures with other PRA1 family members

    • Identify potential binding pockets for Rab GTPases

  • Systems biology integration:

    • Construct gene regulatory networks involving PRA1B2

    • Analyze transcriptome, proteome, and metabolome data from pra1b2 mutants

    • Use weighted gene co-expression network analysis (WGCNA) to identify functional modules

    • Integrate with publicly available gene expression datasets from Expression Atlas

  • Machine learning for phenotype prediction:

    • Train models on multiomics data to predict phenotypic consequences of PRA1B2 perturbation

    • Use transfer learning from well-characterized vesicle trafficking components

    • Identify key descriptors that contribute to functional specificity

  • Protein-protein interaction prediction:

    • Apply protein docking algorithms to predict interactions between PRA1B2 and Rab GTPases

    • Use conservation analysis to identify functionally important residues

    • Perform molecular dynamics simulations of protein complexes to assess stability

  • Evolutionary analysis:

    • Compare PRA1 family expansion across plant lineages

    • Identify selection pressures on different protein domains

    • Trace evolutionary history of interaction networks

    • Predict functional divergence based on selection patterns

  • Pathway modeling:

    • Develop mathematical models of vesicle trafficking pathways

    • Simulate effects of PRA1B2 perturbation on flux through secretory pathways

    • Predict compensatory mechanisms involving other PRA1 family members

Computational approaches provide testable hypotheses about PRA1B2 function that can guide experimental design, leading to more efficient research strategies and deeper insights into the complex role of this protein in plant cellular processes.

What are the challenges and solutions for resolving contradictory data in PRA1B2 research?

Resolving contradictory data in PRA1B2 research requires a structured approach to reconcile discrepancies:

  • Technical variability assessment:

    • Standardize experimental protocols across laboratories

    • Implement robust statistical analyses to account for biological and technical variation

    • Develop consensus positive and negative controls

    • Solution: Establish a collaborative network using identical reagents and standardized protocols

  • Genetic background effects:

    • Challenge: Different Arabidopsis ecotypes may show variable responses to PRA1B2 manipulation

    • Solution: Generate mutants in multiple backgrounds and use complementation tests

    • Create isogenic lines through backcrossing

    • Explicitly report and account for background effects in all publications

  • Functional redundancy within the PRA1 family:

    • Challenge: Single mutant phenotypes may be masked by compensation from other family members

    • Solution: Generate higher-order mutants targeting multiple PRA1 proteins

    • Use inducible systems to avoid developmental compensation

    • Perform detailed expression analysis of all family members in single mutant backgrounds

  • Context-dependent protein interactions:

    • Challenge: Interaction partners may differ depending on cellular context or experimental system

    • Solution: Compare results from multiple interaction detection methods

    • Validate interactions in native plant tissue

    • Use proximity labeling in different cell types and conditions

  • Subcellular localization discrepancies:

    • Challenge: Overexpression or tagging may alter normal localization patterns

    • Solution: Use endogenous promoters and multiple tag positions

    • Compare results from different imaging techniques

    • Validate with immunolocalization of endogenous protein

  • Data integration framework:

    • Develop a systematic approach to weight evidence from different experimental systems

    • Create a centralized database for PRA1 family research results

    • Implement meta-analysis techniques to identify consistent patterns

    • Use Bayesian networks to integrate contradictory evidence

By addressing these challenges systematically, researchers can resolve apparent contradictions and develop a more coherent understanding of PRA1B2 function in plant cells.

What are promising avenues for translational research involving PRA1B2?

Translational research involving PRA1B2 offers several promising directions for agricultural applications:

  • Engineering stress-resilient crops:

    • Modulate PRA1B2 expression to enhance abiotic stress tolerance

    • Fine-tune secretory pathway efficiency during stress responses

    • Develop crops with improved performance under drought, salinity, or temperature extremes

    • Create tissue-specific expression systems for targeted enhancement

  • Improving plant immunity:

    • Enhance pathogen resistance by optimizing PRA1B2-mediated vesicle trafficking

    • Engineer more efficient secretion of antimicrobial compounds

    • Develop plants with improved receptor trafficking for pathogen perception

    • Create conditional expression systems activated during pathogen attack

  • Enhancing nutrient use efficiency:

    • Modify vesicle trafficking pathways to optimize nutrient transporter deployment

    • Improve membrane protein recycling during nutrient limitation

    • Engineer root architecture through targeted PRA1B2 expression

    • Develop crops requiring less fertilizer input

  • Protein production platforms:

    • Optimize secretory pathway efficiency for recombinant protein production in plants

    • Enhance yield and quality of pharmaceutical proteins produced in plant systems

    • Develop plant biofactories with improved protein secretion capabilities

    • Create specialized compartments for protein accumulation

These translational applications require a deep understanding of PRA1B2 function in different cellular contexts and careful assessment of potential pleiotropic effects resulting from its manipulation in crop species.

How can integrative multi-omics approaches advance PRA1B2 research?

Integrative multi-omics approaches can significantly advance PRA1B2 research through these methodological frameworks:

  • Coordinated multi-omics experimental design:

    • Collect matched samples for transcriptomics, proteomics, metabolomics, and phenomics

    • Compare wild-type, pra1b2 knockout, and PRA1B2 overexpression lines

    • Analyze samples under normal and stress conditions

    • Include tissue-specific and developmental time-course analyses

  • Transcriptome-proteome integration:

    • Correlate mRNA and protein abundance changes

    • Identify post-transcriptional regulation

    • Discover differential effects on various cellular pathways

    • Map regulatory networks controlling vesicle trafficking

  • Spatial multi-omics:

    • Apply single-cell RNA-seq to identify cell-type-specific functions

    • Use spatial transcriptomics to map expression patterns within tissues

    • Combine with cell-type-specific proteomics

    • Correlate with subcellular localization data

  • Metabolome-lipidome analysis:

    • Profile metabolite changes in pra1b2 mutants

    • Analyze membrane lipid composition alterations

    • Investigate secondary metabolite transport efficiency

    • Identify metabolic signatures of altered vesicle trafficking

  • Phenomics integration:

    • Deploy high-throughput phenotyping platforms

    • Quantify growth, development, and stress responses

    • Link molecular changes to whole-plant phenotypes

    • Develop predictive models connecting molecular signatures to plant performance

  • Network reconstruction and analysis:

    • Build multi-layered networks incorporating all omics data

    • Identify network motifs and regulatory hubs

    • Discover emergent properties not evident in single-omics analyses

    • Use network perturbation to predict system behavior

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.