Recombinant Arabidopsis thaliana PRA1 family protein C (PRA1C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
PRA1C; At4g29658; T16L4.170; PRA1 family protein C; AtPRA1.C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1C
Target Protein Sequence
MIFRTNYIVIFIVSIFISMLWQPVHLSVFVILIVAWLYVYSRDNEPWVIFGSVIDDSTLV LVLLVLTIGIFLLTDVSRGIVIGVLAGLPVVLVHGMCRRNTEMLFVLEDDEEKVAMNTSS SSLSSSS
Uniprot No.

Target Background

Function
Involved in both secretory and endocytic intracellular trafficking within endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT4G29658

STRING: 3702.AT4G29658.1

UniGene: At.65432

Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the PRA1 protein family in Arabidopsis thaliana and how is PRA1C classified within this family?

The Prenylated Rab Acceptor 1 (PRA1) domain proteins in Arabidopsis thaliana constitute a family of 19 small transmembrane proteins that regulate vesicle trafficking as receptors of Rab GTPases and the vacuolar soluble N-ethylmaleimide-sensitive factor attachment receptor protein VAMP2 . Sequence analysis reveals that higher plants possess an expanded family of PRA1 domain-containing proteins compared to animals and primitive plants .

To classify PRA1C within this family, researchers should:

  • Perform multiple sequence alignment of all 19 AtPRA1 proteins

  • Construct phylogenetic trees using methods such as maximum likelihood or neighbor-joining

  • Analyze conserved motifs and domains specific to PRA1C compared to other family members

  • Examine chromosome location and gene structure as PRA1 genes in Arabidopsis are often arranged in clusters

PRA1C belongs to one of the several subfamilies identified through phylogenetic analysis, with its specific classification determined by sequence homology and evolutionary relationships to other PRA1 proteins.

What are the established expression patterns of PRA1C in Arabidopsis thaliana tissues?

Different AtPRA1 family members display distinct expression patterns, with a preference for vascular cells and expanding or developing tissues . To investigate PRA1C expression specifically:

  • Tissue-specific expression analysis:

    • Use reporter gene fusions (such as PRA1C-promoter::GUS or PRA1C-promoter::GFP)

    • Perform reverse transcription quantitative PCR (RT-qPCR) on different tissues

    • Analyze publicly available expression databases like Arabidopsis eFP Browser or TAIR

  • Developmental stage analysis:

    • Sample tissues at different developmental stages (seedling, mature vegetative, flowering, seed formation)

    • Quantify expression levels using RT-qPCR with PRA1C-specific primers

    • Compare with other PRA1 family members to identify differential expression patterns

  • Response to environmental stimuli:

    • Test expression under different stress conditions (drought, salinity, pathogen infection)

    • Compare expression in wild-type versus mutant backgrounds affecting vesicle trafficking

Like other PRA1 family members, PRA1C likely shows expression in specific tissues and developmental stages, particularly in vascular tissues and areas undergoing active development or expansion .

How can researchers produce recombinant PRA1C protein for in vitro studies?

Production of recombinant PRA1C requires careful consideration of its transmembrane nature. A methodological approach includes:

  • Vector selection and construct design:

    • Choose an expression vector appropriate for membrane proteins (e.g., pET, pGEX, or pMAL)

    • Consider adding affinity tags (His, GST, MBP) to facilitate purification

    • Design constructs with and without transmembrane domains to compare solubility

    • Include TEV or PreScission protease sites for tag removal if necessary

  • Expression system optimization:

    • Test multiple expression systems (E. coli, yeast, insect cells, plant cell cultures)

    • For E. coli, evaluate specialized strains like C41(DE3) or C43(DE3) designed for membrane proteins

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider co-expression with chaperones to improve folding

  • Purification strategy:

    • Extract using detergents suitable for membrane proteins (DDM, LDAO, or Triton X-100)

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Validate protein integrity by Western blotting with anti-PRA1C antibodies

    • Assess protein activity through binding assays with known interactors like Rab GTPases

  • Protein characterization:

    • Verify secondary structure using circular dichroism

    • Analyze oligomeric state using analytical ultracentrifugation or native PAGE

    • Confirm proper folding through limited proteolysis

This methodology accommodates the challenging nature of membrane protein expression while providing high-quality recombinant PRA1C for subsequent structural and functional studies.

What are the molecular mechanisms by which PRA1C interacts with Rab GTPases and other trafficking components?

PRA1 proteins interact with prenylated small GTPases, including Rab proteins and others such as mouse Ha-Ras, N-Ras, TC21, and RhoA, as well as with v-SNARE proteins like VAMP2 . For investigating PRA1C-specific interactions:

  • Identification of interaction partners:

    • Perform yeast two-hybrid screening using PRA1C as bait

    • Implement co-immunoprecipitation with tagged PRA1C from plant extracts

    • Conduct pull-down assays with recombinant PRA1C

    • Use proximity labeling techniques like BioID or APEX in planta

  • Mapping interaction domains:

    • Generate truncation and point mutation variants of PRA1C

    • Test binding affinity using surface plasmon resonance or isothermal titration calorimetry

    • Identify critical residues through alanine scanning mutagenesis

    • Perform in silico molecular docking with Rab GTPases

  • Functional characterization of interactions:

    • Assess the nucleotide dependence (GDP vs. GTP) of Rab-PRA1C interactions

    • Determine if PRA1C shows preference for specific Rab GTPase subfamilies

    • Investigate how membrane localization affects interaction dynamics

    • Examine if PRA1C modulates GTP hydrolysis rates of partner Rab proteins

  • In vivo validation:

    • Use bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

    • Implement Förster resonance energy transfer (FRET) to measure interaction dynamics

    • Analyze phenotypes of plants expressing interaction-deficient PRA1C variants

This comprehensive approach enables researchers to decipher the specific molecular mechanisms by which PRA1C participates in the vesicle trafficking network in Arabidopsis.

How does the subcellular localization of PRA1C compare with other PRA1 family members, and what techniques are best suited for this analysis?

PRA1 family proteins in Arabidopsis localize to various compartments including the Golgi apparatus, endoplasmic reticulum, and endosomal compartments . To investigate PRA1C localization specifically:

  • Fluorescent protein fusion approaches:

    • Generate N- and C-terminal GFP/RFP fusions of PRA1C under native or constitutive promoters

    • Create stable transgenic Arabidopsis lines expressing these fusions

    • Implement transient expression in Nicotiana benthamiana for rapid screening

    • Use super-resolution microscopy techniques (STED, STORM) for detailed localization studies

  • Co-localization with organelle markers:

    CompartmentRecommended MarkersVisualization Method
    GolgiST-RFP, ManI-RFPConfocal microscopy
    ERHDEL-RFP, Calnexin-RFPConfocal microscopy
    TGN/EEVHA-a1-RFP, SYP61-RFPConfocal microscopy
    MVB/LERha1-RFP, ARA7-RFPConfocal microscopy
    Vacuoleγ-TIP-RFPConfocal microscopy
  • Subcellular fractionation and biochemical validation:

    • Perform differential centrifugation to separate cellular compartments

    • Use sucrose gradient fractionation for improved resolution

    • Validate compartment identity with established marker proteins

    • Detect PRA1C in fractions using specific antibodies or epitope tags

  • Comparative analysis with other PRA1 family members:

    • Generate multiple fluorescent fusion constructs for different PRA1 proteins

    • Perform simultaneous imaging to directly compare localization patterns

    • Quantify co-localization coefficients between different PRA1 proteins

    • Analyze dynamics using techniques like fluorescence recovery after photobleaching (FRAP)

These approaches provide complementary data on PRA1C subcellular localization and enable systematic comparison with other family members to elucidate potential functional specialization.

What is the role of PRA1C in plant responses to biotic and abiotic stresses?

Given that vesicle trafficking pathways are often modulated during stress responses, PRA1C may play important roles in plant adaptation to environmental challenges. To investigate this:

  • Expression analysis under stress conditions:

    • Analyze transcriptomic data (RNA-seq, microarray) of plants exposed to various stresses

    • Perform RT-qPCR to quantify PRA1C expression under specific stress conditions

    • Use PRA1C promoter-reporter fusions to visualize tissue-specific stress responses

    • Compare expression patterns with other stress-responsive genes

  • Genetic approaches:

    • Generate and characterize PRA1C knockout/knockdown lines via T-DNA insertion or CRISPR-Cas9

    • Create PRA1C overexpression lines under constitutive or inducible promoters

    • Assess phenotypes under normal and stress conditions (drought, salt, pathogens)

    • Perform complementation tests with wild-type or mutated PRA1C variants

  • Proteomic analysis:

    • Implement co-immunoprecipitation followed by mass spectrometry to identify stress-specific interactors

    • Use phosphoproteomics to detect potential post-translational modifications during stress

    • Analyze protein abundance changes in different subcellular compartments

  • Physiological and biochemical assays:

    Stress TypeRecommended AssaysExpected Outcomes if PRA1C is Involved
    DroughtWater loss rate, stomatal conductanceAltered water retention, stomatal behavior
    SaltIon content analysis, root growthChanges in ion compartmentalization
    ColdElectrolyte leakage, lipid profilingMembrane integrity differences
    PathogenDisease scoring, defense gene expressionModified immune responses

These multi-faceted approaches allow researchers to comprehensively characterize the specific contributions of PRA1C to stress response mechanisms in Arabidopsis.

What are the key considerations for designing gene silencing experiments targeting PRA1C without affecting other PRA1 family members?

When designing gene silencing experiments that specifically target PRA1C while avoiding off-target effects on other PRA1 family members:

  • siRNA/RNAi design strategy:

    • Identify unique regions in PRA1C sequence not conserved in other family members

    • Design multiple siRNA candidates targeting these unique regions

    • Use algorithms like siDirect or RNAi Designer to minimize off-target prediction

    • Test candidate siRNAs in silico against the Arabidopsis transcriptome to ensure specificity

  • Vector construction for stable transformation:

    • Design hairpin constructs with PRA1C-specific segments (typically 300-500 bp)

    • Use gateway cloning to generate plant transformation vectors

    • Consider using inducible promoters (e.g., estradiol-inducible) for controlled silencing

    • Include appropriate selection markers for transgenic plant screening

  • Validation of specificity:

    Validation ApproachMethodologyExpected Outcome
    qRT-PCR panelDesign primers for all PRA1 family membersOnly PRA1C shows reduced expression
    Western blottingUse specific antibodies for PRA1 family proteinsOnly PRA1C shows reduced protein levels
    RNA-seqGlobal transcriptome analysisNo significant changes in other PRA1 genes
  • CRISPR-Cas9 alternatives:

    • Design guide RNAs targeting PRA1C-specific exons

    • Implement CRISPR interference (CRISPRi) for transcriptional repression

    • Consider base editing approaches for knockdown without complete knockout

    • Use tissue-specific promoters to drive Cas9 expression for localized effects

  • Mitigating functional redundancy:

    • Identify the most closely related PRA1 family members to PRA1C

    • Consider generating double or triple mutants if single mutations show subtle phenotypes

    • Implement artificial microRNA (amiRNA) approaches for fine-tuned silencing

This methodological framework ensures highly specific targeting of PRA1C while providing multiple validation steps to confirm the absence of off-target effects on other PRA1 family members.

What approaches are recommended for studying PRA1C protein-protein interactions in planta?

To effectively study PRA1C protein-protein interactions in the native plant context:

  • In vivo protein-protein interaction methods:

    • Bimolecular Fluorescence Complementation (BiFC):

      • Split YFP/GFP tags fused to PRA1C and candidate interactors

      • Transient expression in Nicotiana benthamiana

      • Stable transformation in Arabidopsis for long-term studies

      • Use appropriate controls including non-interacting proteins

    • Förster Resonance Energy Transfer (FRET):

      • Generate donor-acceptor fluorophore pairs (e.g., CFP-YFP)

      • Measure energy transfer using acceptor photobleaching or fluorescence lifetime imaging

      • Calculate FRET efficiency to quantify interaction strength

      • Compare with known interacting and non-interacting protein pairs

    • Split luciferase complementation:

      • Fusion proteins with N- and C-terminal luciferase fragments

      • Monitor luminescence upon substrate addition

      • Allows for quantitative assessment of interaction dynamics

      • Suitable for high-throughput screening approaches

  • Co-immunoprecipitation strategies:

    • Use epitope-tagged PRA1C expressed under native promoter

    • Implement optimized membrane protein extraction protocols

    • Perform reciprocal co-IPs to confirm interactions

    • Follow with mass spectrometry for unbiased interactome analysis

  • Proximity-dependent labeling techniques:

    TechniquePrincipleAdvantagesLimitations
    BioIDBiotin ligase fusionDetects weak/transient interactionsRequires biotin supplementation
    APEXPeroxidase-mediated biotinylationRapid labeling (minutes)Requires H₂O₂ treatment
    TurboIDEnhanced biotin ligaseHigher efficiency than BioIDPotential background issues
  • Genetic interaction studies:

    • Generate crosses between pra1c mutants and mutants of putative interactors

    • Analyze phenotypes for enhancement or suppression effects

    • Perform complementation tests with modified versions of PRA1C

    • Correlate genetic interactions with physical interaction data

  • Validation through functional assays:

    • Design assays to test the biological relevance of identified interactions

    • For Rab GTPase interactions, measure effects on vesicle trafficking dynamics

    • For SNARE interactions, assess impact on membrane fusion events

    • Implement live cell imaging to visualize interaction consequences

This comprehensive toolbox enables researchers to detect, validate, and functionally characterize the PRA1C interactome in physiologically relevant conditions.

How should researchers design experiments to investigate the evolutionary conservation of PRA1C function across different plant species?

To systematically investigate the evolutionary conservation of PRA1C function across the plant kingdom:

  • Comparative genomics approach:

    • Identify PRA1C homologs in diverse plant species spanning evolutionary distance

    • Include representatives from angiosperms, gymnosperms, ferns, mosses, and algae

    • Perform phylogenetic analysis to establish orthology relationships

    • Analyze gene structure conservation and syntenic relationships

  • Expression pattern comparison:

    • Design universal primers targeting conserved regions of PRA1C

    • Perform RT-qPCR on comparable tissues across species

    • Generate promoter-reporter fusions from different species and express in Arabidopsis

    • Analyze publicly available transcriptome data across species

  • Cross-species complementation:

    Experimental DesignMethodologyExpected Outcomes
    Arabidopsis pra1c mutant + orthologTransform with PRA1C orthologs from other speciesPhenotype rescue indicates conserved function
    Heterologous expressionExpress tagged orthologs in ArabidopsisSimilar localization suggests conserved targeting
    Domain swappingCreate chimeric proteins with domains from different speciesIdentify functionally conserved protein regions
  • Protein interaction conservation:

    • Test interactions between PRA1C orthologs and Arabidopsis interacting partners

    • Identify conserved binding motifs through sequence alignment and structural modeling

    • Perform cross-species BiFC or pull-down assays to validate interaction conservation

    • Map species-specific differences in interaction strength or specificity

  • Functional conservation in vesicle trafficking:

    • Develop trafficking assays measurable across multiple species

    • Use fluorescent cargo proteins to track trafficking efficiency

    • Implement CRISPR-Cas9 to generate equivalent mutations across species

    • Compare phenotypic consequences in different model plant systems

This methodological framework provides a comprehensive assessment of functional conservation while identifying species-specific adaptations in PRA1C function throughout plant evolution.

How can researchers resolve contradictory findings between in vitro and in planta studies of PRA1C function?

Reconciling contradictions between in vitro and in planta experimental results requires systematic investigation:

  • Systematic comparison of experimental conditions:

    • Document all differences between experimental systems (buffer composition, pH, temperature)

    • Assess protein modifications present in planta but absent in vitro (glycosylation, phosphorylation)

    • Evaluate membrane composition differences that might affect protein behavior

    • Consider the presence of additional factors in planta that might modulate activity

  • Bridging methodologies:

    • Implement semi-in vitro systems (plant cell extracts, isolated organelles)

    • Use reconstituted membrane systems with defined lipid composition

    • Gradually increase complexity from purified components to cellular context

    • Test activity across a spectrum of conditions to identify critical parameters

  • Validation through complementary approaches:

    Contradictory FindingBridging ApproachResolution Strategy
    Protein interactionsCompare yeast 2-hybrid with in planta BiFCIdentify conditions affecting interaction stability
    Subcellular localizationTest localization in protoplasts vs. intact tissuesAssess tissue-specific factors influencing targeting
    Enzymatic activityMeasure activity in various buffer conditionsIdentify physiological conditions mimicking in planta environment
  • Critical analysis of experimental limitations:

    • Evaluate potential artifacts in both systems (protein tags interfering with function)

    • Assess temporal aspects (acute vs. chronic manipulations)

    • Consider dose-dependent effects (overexpression vs. endogenous levels)

    • Analyze tissue-specific or developmental context dependencies

  • Integrative modeling approach:

    • Develop mathematical models incorporating all experimental data

    • Identify parameter spaces that reconcile seemingly contradictory results

    • Make testable predictions to validate the integrative model

    • Iteratively refine the model based on new experimental findings

This framework provides a structured approach to resolving contradictions through systematic investigation and integration of multiple experimental paradigms, ultimately leading to a more complete understanding of PRA1C function.

What statistical approaches are most appropriate for analyzing phenotypic data from PRA1C mutant lines?

  • Experimental design considerations:

    • Implement randomized complete block designs to control environmental variables

    • Determine appropriate sample sizes through power analysis

    • Include multiple independent transgenic lines for each construct

    • Use segregating populations to control for insertion effects

  • Quantitative trait analysis:

    • Continuous variables (growth measurements, gene expression):

      • Apply ANOVA followed by appropriate post-hoc tests (Tukey's HSD, Dunnett's)

      • Use mixed-effects models when incorporating random factors (block, experiment)

      • Implement ANCOVA when controlling for covariates (plant size, developmental stage)

      • Consider non-parametric alternatives (Kruskal-Wallis) for non-normally distributed data

    • Categorical variables (phenotypic classes, stress response categories):

      • Use chi-square or Fisher's exact tests for frequency comparisons

      • Apply logistic regression for binary outcomes with multiple predictors

      • Consider ordinal logistic regression for ranked phenotypic data

  • Multivariate approaches for complex phenotypes:

    Statistical MethodApplicationAdvantages
    Principal Component AnalysisReducing dimensionality of phenotypic dataIdentifies major sources of variation
    Discriminant AnalysisClassifying genotypes based on phenotypic profilesTests separation between groups
    Cluster AnalysisIdentifying natural groupings in phenotypic dataReveals patterns without prior grouping
    MANOVATesting group differences across multiple variablesControls experiment-wise error rate
  • Time-series data analysis:

    • Apply repeated measures ANOVA for balanced designs

    • Use linear mixed models for unbalanced time points

    • Implement functional data analysis for continuous monitoring data

    • Consider growth curve modeling for developmental trajectories

  • Integrating multiple data types:

    • Develop correlation networks between phenotypic and molecular data

    • Implement structural equation modeling to test causal relationships

    • Use machine learning approaches for phenotypic prediction from molecular markers

    • Apply Bayesian networks to integrate prior knowledge with experimental data

How can researchers distinguish between direct and indirect effects of PRA1C on cellular processes?

Differentiating direct from indirect effects requires careful experimental design and multiple complementary approaches:

  • Temporal resolution studies:

    • Implement inducible systems (estradiol, dexamethasone) to control PRA1C expression

    • Perform time-course experiments following induction or repression

    • Analyze rapid responses (minutes to hours) vs. delayed effects (days)

    • Use transcriptional and translational inhibitors to distinguish primary from secondary effects

  • Direct interaction verification:

    • Perform in vitro binding assays with purified components

    • Implement proximity labeling with short labeling windows (minutes)

    • Use protein crosslinking to capture transient interactions

    • Create non-binding PRA1C mutants to confirm interaction requirements

  • Pathway dissection approaches:

    ApproachMethodologyExpected Outcome for Direct Effects
    Genetic epistasisAnalyze double mutants with upstream/downstream componentsNon-additive phenotypes with direct targets
    Pharmacological interventionApply specific inhibitors at defined stepsBlock PRA1C effects only if target is downstream
    Bypass experimentsExpress downstream components in pra1c backgroundRescue if effect is direct
  • Subcellular resolution analysis:

    • Implement compartment-specific PRA1C targeting

    • Use optogenetic tools for spatiotemporal control of PRA1C activity

    • Perform organelle isolation followed by activity assays

    • Track cargo movement through specific compartments

  • Systems biology approaches:

    • Create causal networks from time-resolved omics data

    • Implement mathematical modeling to predict direct vs. indirect relationships

    • Perform targeted perturbations to validate model predictions

    • Use network analysis to identify direct connection nodes

  • Domain-specific functional analysis:

    • Generate PRA1C variants with mutations in distinct functional domains

    • Test each variant for specific subset of phenotypes

    • Map structural requirements for different cellular processes

    • Correlate domain functionality with interaction partners

This integrated approach enables researchers to systematically distinguish direct PRA1C functions from downstream consequences, providing a mechanistic understanding of how this protein contributes to cellular processes.

What are the current limitations in PRA1C research and what breakthroughs might advance the field?

Current limitations in PRA1C research include the challenges of working with membrane proteins, potential functional redundancy within the large PRA1 family in Arabidopsis, and incomplete understanding of the mechanistic details of PRA1C's role in vesicle trafficking. Future breakthroughs may come from applying emerging technologies like cryo-electron microscopy to resolve PRA1C structure, implementing genome-wide CRISPR screens to identify genetic interactions, and developing advanced live cell imaging techniques to visualize PRA1C dynamics in real time.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.