Recombinant Arabidopsis thaliana PRA1 family protein D (PRA1D)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PRA1D; MPI7; MPIP7; PRA5; At1g04260; F19P19.30; PRA1 family protein D; AtPRA1.D; CAMV MOVEMENT PROTEIN-INTERACTING PROTEIN 7; Prenylated Rab acceptor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1D
Target Protein Sequence
MANQVITGIKETAQSITGAARPWGDFLDLSAFSFPSSIADATTRVTQNLTHFRINYSIIL SILLGLTLITRPIAILAFIAVGLAWFFLYFAREEPLTIFGFTIDDGIVAVLLIGLSIGSL VTTGVWLRALTTVGFGVLVLILHAALRGTDDLVSDDLESPYGPMLSTSGGGNDGARGDYS GI
Uniprot No.

Target Background

Function
Involved in both secretory and endocytic intracellular trafficking within endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT1G04260

STRING: 3702.AT1G04260.1

UniGene: At.21183

Protein Families
PRA1 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hypocotyls, roots, lateral roots, lateral root caps, columella cells, leaves, shoot apex, stems and flowers.

Q&A

What is PRA1D and how does it relate to other PRA1 family members in Arabidopsis?

PRA1D is one of 19 members of the Prenylated Rab Acceptor 1 (PRA1) domain protein family in Arabidopsis thaliana. These proteins are small transmembrane regulators of vesicle trafficking that function as receptors for Rab GTPases and the v-SNARE protein VAMP2 . The Arabidopsis PRA1 (AtPRA1) family is classified into eight distinct clades (A-H), with PRA1D belonging to clade D .

Phylogenetic analysis reveals that higher plants, including Arabidopsis, poplar, and rice, possess an expanded PRA1 family compared to animals and primitive plants, suggesting evolutionary diversification and functional specialization . Like other family members, PRA1D likely participates in both secretory and endocytic intracellular trafficking pathways, though with tissue-specific expression patterns and potentially distinct functional roles .

What are the structural characteristics of PRA1D?

PRA1D, like other AtPRA1 proteins, consists of approximately 180-240 amino acid residues with a predicted molecular mass between 20-26 kD . The protein contains multiple transmembrane domains (typically two or more), which are critical for its membrane localization and function .

The small size of PRA1D is a conserved feature across species, with human PRA1 (185 amino acids, 20.6 kD) and yeast PRA1 (176 amino acids, 19.4 kD) showing similar dimensions . The transmembrane topology of PRA1D allows it to anchor within cellular membranes, positioning it to participate in vesicle trafficking processes between different compartments.

Where is PRA1D localized within plant cells?

PRA1D, along with other PRA1 family members, has been localized to various membrane compartments involved in intracellular trafficking. Subcellular localization studies have demonstrated that AtPRA1 proteins can be found in the endoplasmic reticulum (ER), Golgi apparatus, and endosomes/prevacuolar compartments .

This diverse localization pattern suggests that PRA1D may function at multiple stages of vesicle transport within both secretory and endocytic pathways . The specific compartmental distribution of PRA1D may depend on developmental stage, tissue type, and environmental conditions, reflecting its specialized functions in different cellular contexts.

What expression systems are most effective for recombinant PRA1D production?

For recombinant production of PRA1D, researchers should consider several expression systems with the following methodological approaches:

  • E. coli-based expression: Using BL21(DE3) or similar strains with codon optimization for plant proteins. Fusion tags such as His6, GST, or MBP can improve solubility. For membrane proteins like PRA1D, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression may yield better results.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae can provide a eukaryotic environment with appropriate post-translational modifications. For PRA1D, the methylotrophic yeast P. pastoris often provides better expression of plant membrane proteins.

  • Plant-based expression: Transient expression in Nicotiana benthamiana using Agrobacterium-mediated infiltration can maintain native folding and post-translational modifications. Alternatively, stable expression in Arabidopsis cell suspension cultures may be advantageous when studying protein interactions relevant to the native environment.

Expression temperatures should be optimized (typically 16-22°C is preferred over 37°C) to improve proper folding of recombinant PRA1D, and induction conditions should be carefully titrated to balance yield with proper folding.

What purification strategies are recommended for recombinant PRA1D?

Purification of recombinant PRA1D requires careful consideration of its membrane-associated nature:

  • Membrane extraction: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations slightly above their critical micelle concentration (CMC).

  • Affinity chromatography: For His-tagged PRA1D, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins under optimized imidazole concentrations to minimize non-specific binding while maximizing target protein recovery.

  • Size exclusion chromatography: As a polishing step, SEC can separate properly folded PRA1D from aggregates and remove remaining contaminants while maintaining the protein in appropriate detergent micelles.

  • Detergent exchange: Consider exchanging harsh detergents used in extraction with milder ones during purification, or utilize amphipols or nanodiscs for stabilizing the purified protein in a membrane-like environment.

Throughout purification, maintain glycerol (10-15%) and reducing agents in buffers to prevent aggregation and oxidation, and keep samples at 4°C to minimize degradation.

How can interactions between PRA1D and Rab GTPases be effectively studied?

Based on the known function of PRA1 proteins as Rab GTPase receptors , several methodological approaches can be employed to study PRA1D-Rab interactions:

  • Yeast two-hybrid assays: As demonstrated with other AtPRA1 proteins, Y2H can detect direct interactions between PRA1D and various Rab GTPases . For membrane proteins like PRA1D, specialized membrane-based Y2H systems may provide more physiologically relevant results.

  • Co-immunoprecipitation: Using epitope-tagged PRA1D (e.g., HA or FLAG) and Rab proteins expressed in plant cells, followed by pull-down assays and western blot analysis to verify interactions.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing split fluorescent protein fragments to PRA1D and candidate Rab GTPases, interactions can be visualized in living plant cells, providing spatial information about where these interactions occur.

  • Surface Plasmon Resonance (SPR): For quantitative binding parameters, purified recombinant PRA1D can be immobilized on sensor chips and binding kinetics with various Rab GTPases measured.

  • Proximity Labeling Approaches: BioID or TurboID fused to PRA1D can identify proximal proteins in vivo, potentially revealing novel Rab GTPase interactions not predicted by sequence homology.

When designing these experiments, it's crucial to include appropriate controls, such as testing interactions with mutated versions of Rab GTPases (constitutively active or dominant negative) to assess nucleotide dependence of the interactions.

What evidence supports PRA1D homo- and heterodimerization?

AtPRA1 family members have been shown to form both homodimers and heterodimers, with interaction patterns largely corresponding to their phylogenetic distribution . While specific information about PRA1D is not directly provided in the search results, the family-wide pattern suggests:

  • Clade-specific interactions: Members of the same clade typically show similar interaction profiles . PRA1D, belonging to clade D, likely interacts with other clade D members as well as potentially with members of clades F and G, as these clades were found to form a smaller interaction network .

  • Experimental evidence: Yeast two-hybrid assays have demonstrated both homo- and heterodimerization among AtPRA1 proteins . The dimerization pattern revealed two main interaction networks, with clade D participating in one of these networks .

Type of InteractionDetection MethodBiological Significance
HomodimerizationYeast two-hybridMay regulate protein function through conformational changes
Heterodimerization (within clade)Yeast two-hybridLikely provides functional redundancy
Heterodimerization (between clades)Yeast two-hybridMay coordinate trafficking between different compartments

The biological significance of these dimerization events may include regulation of protein activity, stabilization of protein complexes, or coordination of trafficking events between different cellular compartments.

What is known about the expression pattern of PRA1D in Arabidopsis tissues?

While the search results don't provide PRA1D-specific expression data, they indicate that AtPRA1 family members generally display distinct expression patterns with preferences for vascular cells and expanding or developing tissues . This information can guide researchers in designing tissue-specific studies for PRA1D:

  • Promoter-reporter studies: Following the approach used for other AtPRA1 genes, researchers can generate transgenic Arabidopsis plants harboring the PRA1D promoter region fused to reporter genes like GUS or fluorescent proteins . Analysis in 8-day-old seedlings would be particularly informative, as this stage exhibits high vesicular activity linked to rapid growth .

  • Tissue-specific expression: Based on the pattern observed for other family members, PRA1D may show expression in vascular tissues and zones of active cell division or expansion . Examining root tips, shoot apical meristems, and developing leaves would be recommended.

  • Developmental regulation: Expression patterns should be monitored across different developmental stages to identify temporal regulation of PRA1D expression .

The observed expression patterns can provide valuable insights into the specific cellular processes and developmental contexts in which PRA1D functions, guiding further functional characterization experiments.

How can researchers generate reliable expression data for PRA1D?

To generate reliable expression data for PRA1D, researchers should employ multiple complementary approaches:

  • Quantitative RT-PCR: Design gene-specific primers ensuring they don't amplify other PRA1 family members. Include reference genes appropriate for the tissues and conditions being studied.

  • RNA-Seq analysis: For genome-wide expression profiling, RNA-Seq can provide comprehensive expression data and identify co-expressed genes, as was done to reveal the significant co-expression of AtPRA1 genes with Rab GTPases and vesicle transport proteins .

  • Translational fusions: For protein-level expression, C-terminal or N-terminal fusions with fluorescent proteins can provide spatial information about expression, though care must be taken to ensure the fusion doesn't disrupt localization or function.

  • Immunolocalization: Development of specific antibodies against PRA1D can enable protein detection in fixed tissues, though cross-reactivity with other PRA1 family members must be carefully controlled.

  • Single-cell RNA-Seq: For high-resolution expression data, single-cell approaches can reveal cell type-specific expression patterns that might be masked in whole-tissue analysis.

In all cases, proper controls and biological replicates are essential for statistical validation of the expression patterns observed.

What genetic approaches can be used to study PRA1D function in vivo?

Several genetic approaches can be employed to characterize PRA1D function in vivo:

Genetic ApproachAdvantagesLimitationsRecommended Controls
T-DNA insertionsReadily availableFunctional redundancy, position effectsMultiple independent alleles
CRISPR-Cas9Precise targeting, multiplex capabilityOff-target effectsComplementation with wild-type gene
amiRNATargeting specificity, inducible optionsVariable knockdown efficiencyTranscript level verification
OverexpressionCircumvents redundancyPotential artifacts from ectopic expressionMultiple independent lines with varying expression levels

When interpreting results from these genetic approaches, researchers should consider the potential for compensatory mechanisms within the PRA1 family network.

How can researchers study the role of PRA1D in vesicle trafficking?

Given that PRA1 proteins function in vesicle trafficking as receptors for Rab GTPases , several methodological approaches can be employed to study PRA1D's specific role:

  • Live cell imaging: Use fluorescently tagged vesicle markers in combination with tagged PRA1D to track vesicle formation, movement, and fusion in real-time using spinning disk or total internal reflection fluorescence (TIRF) microscopy.

  • Cargo trafficking assays: Monitor the transport of specific cargo proteins (e.g., secreted proteins, vacuolar proteins) in wild-type versus PRA1D mutant or overexpression lines to identify specific trafficking pathways affected.

  • Co-localization studies: Determine the extent of overlap between PRA1D and markers for specific compartments (ER, Golgi, TGN, endosomes) using confocal microscopy to infer sites of action.

  • Pharmacological approaches: Use inhibitors of vesicle trafficking (e.g., Brefeldin A, Wortmannin) in combination with genetic manipulation of PRA1D to identify specific steps in trafficking pathways where PRA1D functions.

  • Ultrastructural analysis: Employ transmission electron microscopy to examine changes in compartment morphology or vesicle accumulation in PRA1D mutants or overexpression lines.

When designing these experiments, researchers should consider the potential functional overlap with other PRA1 family members and include appropriate controls to distinguish PRA1D-specific effects from general perturbations of the trafficking machinery.

How can researchers distinguish between the functions of different PRA1 family members?

Distinguishing the specific functions of PRA1D from other PRA1 family members presents a significant challenge due to potential functional redundancy among the 19 AtPRA1 proteins . Several strategic approaches can address this challenge:

  • Domain swapping experiments: Create chimeric proteins by swapping domains between PRA1D and other family members to identify regions responsible for functional specificity.

  • Expression pattern analysis: Compare detailed expression maps (spatial and temporal) of PRA1D with other family members to identify unique expression domains where PRA1D may have non-redundant functions .

  • Co-expression network analysis: Identify genes specifically co-expressed with PRA1D but not with other family members to infer unique functional associations .

  • Interaction specificity: Compare the interaction profiles of PRA1D with other family members to identify unique protein-protein interactions that may indicate specialized functions .

  • Higher-order mutants: Generate mutants lacking multiple PRA1 family members in addition to PRA1D to uncover functions masked by redundancy. Prioritize combinations based on phylogenetic relationships and expression patterns.

What approaches can help resolve conflicting data in PRA1D research?

When faced with conflicting results in PRA1D research, consider these methodological approaches:

  • Standardize experimental conditions: Ensure that seemingly contradictory results aren't due to differences in growth conditions, developmental stages, or genetic backgrounds.

  • Control for specificity: Verify that the observed effects are specifically due to PRA1D manipulation rather than off-target effects or perturbation of related family members. Include complementation controls in genetic studies.

  • Consider tissue-specific effects: PRA1D may have different or even opposing functions in different tissues or cell types. Employ tissue-specific promoters or cell type-specific markers to resolve spatial differences.

  • Temporal dynamics: Examine whether conflicting data might reflect different temporal phases of PRA1D activity. Use time-course experiments and inducible systems to resolve temporal dynamics.

  • Integrate multiple data types: Combine genetic, biochemical, and cell biological approaches to build a more comprehensive understanding. No single experimental approach can fully capture the complex functions of trafficking regulators like PRA1D.

  • Quantitative analysis: Apply rigorous statistical methods to determine whether apparent conflicts are statistically significant or within the range of normal experimental variation.

How does PRA1D contribute to plant responses to environmental stresses?

Given that vesicle trafficking plays crucial roles in plant stress responses and that AtPRA1 genes show distinct expression patterns in developing tissues , researchers can explore PRA1D's role in stress responses through these approaches:

  • Stress-responsive expression analysis: Monitor PRA1D expression under various biotic and abiotic stresses (drought, salt, pathogens, temperature) using qRT-PCR or RNA-Seq approaches.

  • Comparison with stress-responsive genes: Examine whether PRA1D is co-expressed with known stress-response genes or pathways, similar to how other AtPRA1 genes were found to be co-expressed with vesicle trafficking components .

  • Phenotypic analysis of stress responses: Compare wild-type, PRA1D mutant, and overexpression lines for differences in tolerance to various stresses. Measure physiological parameters such as reactive oxygen species accumulation, ion leakage, or hormonal responses.

  • Integration with hormone signaling: Investigate potential connections between PRA1D function and hormone-mediated stress responses, particularly in light of the demonstrated role of Arabidopsis genes in enhancing disease resistance in other plant species .

Research in this direction could reveal novel connections between membrane trafficking and stress adaptation mechanisms in plants.

What are the translational implications of PRA1D research for crop improvement?

While the search results don't directly address PRA1D's potential in crop improvement, the translational potential of Arabidopsis research is well-established . Researchers could explore:

  • Functional conservation in crops: Identify and characterize PRA1D orthologs in important crop species to determine whether functions are conserved. This could build on the comparative genomic analysis showing expansion of the PRA1 family in higher plants .

  • Engineering trafficking efficiency: Modulating PRA1D expression might enhance secretion of defense compounds or improve nutrient uptake through altered trafficking dynamics, similar to how other Arabidopsis genes have been used to enhance disease resistance in crops .

  • Stress tolerance engineering: If PRA1D plays a role in stress responses, its orthologs could be targeted for engineering improved stress tolerance in crops, following the model of how Arabidopsis NPR1 has been used to enhance disease resistance in various crops .

  • Protein production platforms: Understanding PRA1D's role in vesicle trafficking could inform strategies to improve production of recombinant proteins in plant-based expression systems.

This translational research would build on the foundational understanding of PRA1D function in Arabidopsis to address practical challenges in agriculture.

Why might recombinant PRA1D expression yield low protein amounts or inclusion bodies?

As a small transmembrane protein , recombinant expression of PRA1D can face several challenges that researchers should address methodically:

  • Membrane protein solubility: The multiple transmembrane domains in PRA1D can cause aggregation during expression. Use fusion partners that enhance solubility (MBP, SUMO, Trx) and optimize detergent selection for extraction.

  • Expression temperature: Lower temperatures (16-20°C) often improve proper folding of membrane proteins. Implement a systematic temperature gradient test to determine optimal conditions.

  • Induction parameters: High induction levels can overwhelm the cell's capacity to properly insert membrane proteins. Use lower inducer concentrations and longer expression times.

  • Codon optimization: Adapt the PRA1D coding sequence to the codon usage preference of the expression host to improve translation efficiency.

  • Signal sequence considerations: For proper membrane insertion, evaluate whether including or modifying native signal sequences improves expression outcomes.

If inclusion bodies are unavoidable, consider whether denaturation and refolding protocols might be adapted for PRA1D, or shift to eukaryotic expression systems that may better accommodate plant membrane proteins.

How can specificity issues in PRA1D antibody development be addressed?

Developing specific antibodies against PRA1D presents challenges due to the presence of 18 other family members with potentially similar epitopes . To address this:

  • Epitope selection: Identify unique regions in PRA1D that have minimal sequence similarity with other family members. N- or C-terminal regions often show greater divergence than transmembrane domains.

  • Peptide antibodies: Use synthetic peptides corresponding to unique regions for immunization, rather than full-length protein.

  • Validation controls: Test antibody specificity against recombinant PRA1D alongside other family members. Include PRA1D knockout/knockdown lines as negative controls in immunoblots or immunolocalization.

  • Pre-absorption controls: Pre-absorb antibodies with recombinant proteins of closely related family members to remove cross-reactive antibodies.

  • Epitope tagging alternative: If specific antibodies prove difficult to generate, consider epitope tagging approaches (HA, FLAG, myc) in transgenic plants for detection of PRA1D.

By carefully implementing these strategies, researchers can develop and validate antibodies that specifically recognize PRA1D without cross-reactivity to other family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.