Recombinant Arabidopsis thaliana PRA1 family protein E (PRA1E)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
PRA1E; PRA4; At1g08770; F22O13.26; PRA1 family protein E; AtPRA1.E; Prenylated Rab acceptor 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1E
Target Protein Sequence
MNQKPPPYGYGGAGGGGVGPSSTSNTTIIGTLSARAKQTTQSMITTLRPWREILDLSALS LPRGYDEAMAHLKHNISYFRGNYALAVLAIVFLGLIYHPMSMIAFIVVFIGWILLYFSRD ANDSIVISGKEVDDKIVLVLLSLVTVLALVYTDVGENVLVSLIIGLLIVGAHGAFRNTDD LFLDEESARRGGLVSAGSGNRPPSSYTPI
Uniprot No.

Target Background

Function
Involved in both secretory and endocytic intracellular trafficking within endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT1G08770

STRING: 3702.AT1G08770.1

UniGene: At.27752

Protein Families
PRA1 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hypocotyls, roots, lateral roots, columella cells, leaves and shoot apex.

Q&A

What are the key functional domains of PRA1E protein?

PRA1E, like other members of the PRA1 family, is a four-pass transmembrane protein with key functional domains that determine its subcellular localization and interaction capabilities. Based on research on PRA1 family proteins, these domains include:

  • N-terminal cytosolic region: Contains trafficking motifs including di-arginine and FFAT-like motifs that are important for endoplasmic reticulum (ER) retention and retrieval

  • Four transmembrane domains: Essential for membrane integration

  • C-terminal cytosolic region: Contains Golgi targeting information, including a di-acidic motif (DGE) required for ER exit

Understanding these domains is crucial for designing functional studies, as modifications (such as adding tags) to either terminus can significantly alter the protein's localization and function .

What are the known synonyms and identifiers for PRA1E?

When searching literature and databases for information on PRA1E, researchers should be aware of all synonyms and identifiers to ensure comprehensive results:

TypeIdentifier/Name
Gene NamePRA1E
SynonymsPRA4, AtPRA1.E, Prenylated Rab acceptor 4
Locus IDAt1g08770
Clone IDF22O13.26
UniProt IDQ9FRR1

These alternative identifiers are essential for comprehensive literature searches and database queries when researching this protein .

What are the optimal storage conditions for recombinant PRA1E protein?

For optimal stability and activity of recombinant PRA1E protein, follow these evidence-based storage protocols:

  • Upon receipt, store the lyophilized powder at -20°C to -80°C

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • For long-term storage, add glycerol to a final concentration of 50% and store at -20°C to -80°C

  • For working solutions needed within one week, store aliquots at 4°C

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability

The protein stability is significantly compromised by multiple freeze-thaw cycles, potentially affecting experimental results. Working aliquots should be prepared in volumes appropriate for single experiments to avoid this issue.

How should recombinant PRA1E protein be reconstituted for experimental use?

Proper reconstitution is critical for maintaining protein activity. Follow this methodological approach:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for stability (50% is recommended)

  • Gently mix by inversion rather than vortexing to avoid protein denaturation

  • Allow the protein to fully dissolve before use or storage

The reconstitution buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is optimized to maintain protein stability while providing a compatible environment for most biochemical and cellular assays .

What experimental controls should be used when working with recombinant Arabidopsis PRA1E?

When designing experiments with recombinant PRA1E, include these essential controls:

  • Negative controls:

    • Buffer-only treatments matching the reconstitution buffer

    • Unrelated recombinant protein with similar tag and expression system

    • Heat-denatured PRA1E to distinguish between specific activity and non-specific effects

  • Positive controls:

    • When studying protein-protein interactions, include known interaction partners

    • For trafficking studies, include markers for relevant compartments (Golgi, ER)

  • Validation controls:

    • Western blotting to confirm protein integrity and concentration

    • Activity assays relevant to the protein's function

    • Localization confirmation using fluorescently-tagged versions along with appropriate compartment markers

These controls are essential for rigorous scientific investigation and help distinguish true biological effects from artifacts.

How does the addition of tags affect the subcellular localization of PRA1E?

The addition of tags to PRA1E significantly impacts its subcellular localization, an important consideration for experimental design:

  • N-terminal tags:

    • Typically result in predominant Golgi localization

    • May interfere with N-terminal di-arginine and FFAT-like motifs that mediate ER retention

  • C-terminal tags:

    • Often lead to reticular ER localization

    • May disrupt C-terminal Golgi targeting information

  • Tag-free approaches:

    • Using antibodies against native protein shows that endogenous PRA1 family proteins distribute between both Golgi and ER compartments, with enrichment at ER-mitochondria contact sites

These differential localizations do not fully recapitulate the distribution of the endogenous protein, which typically shows a more complex distribution pattern . Researchers should carefully consider tag placement based on their experimental questions and validate localization using multiple approaches.

What trafficking motifs in PRA1E determine its subcellular distribution?

PRA1E contains several trafficking motifs that determine its complex subcellular distribution:

  • ER retention/retrieval motifs on N-terminal region:

    • Di-arginine motif: Functions as an ER retrieval signal

    • FFAT-like motif: Novel membrane-proximal sequence facilitating ER retention

  • ER exit/Golgi targeting on C-terminal region:

    • Di-acidic motif (DGE): Required for ER exit and entry into COPII vesicles

    • Additional Golgi retention signals

The presence of both ER retention and Golgi targeting signals suggests that PRA1E likely cycles between these compartments, with its steady-state distribution determined by the balance of these competing signals . Mutation of either ER retention motif leads to increased cell surface localization of truncation constructs, while mutation of both shows additive effects, demonstrating their functional importance.

How can researchers accurately determine the authentic subcellular distribution of PRA1E?

To accurately determine the authentic subcellular distribution of PRA1E, researchers should employ multiple complementary approaches:

  • Immunolocalization of endogenous protein:

    • Use validated antibodies against different epitopes of the protein

    • Perform co-localization studies with established compartment markers

  • Fluorescent protein fusions with minimal interference:

    • Consider split-GFP or small epitope tags as alternatives to full fluorescent proteins

    • Create both N- and C-terminal fusions to compare distribution patterns

    • Validate functionality of fusion proteins

  • Subcellular fractionation and biochemical approaches:

    • Perform careful subcellular fractionation followed by western blotting

    • Use density gradient separation to resolve different membrane compartments

    • Analyze post-translational modifications that might differ between compartments

  • Super-resolution microscopy:

    • Employ techniques like STORM or PALM for nanometer-scale resolution

    • Use multi-color imaging to precisely define compartment boundaries

By combining these approaches, researchers can build a more accurate picture of the true subcellular distribution of PRA1E, avoiding artifacts associated with any single technique.

What expression systems are optimal for producing functional recombinant PRA1E?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant PRA1E:

  • Bacterial expression (E. coli):

    • Advantages: High yield, simple culture conditions, cost-effective

    • Limitations: Potential improper folding of transmembrane domains, lack of post-translational modifications

    • Optimization strategies: Use specialized strains (Rosetta, C41/C43), low-temperature induction, fusion partners to enhance solubility

    • Successfully employed for full-length PRA1E (1-209aa) with N-terminal His tag

  • Yeast expression (P. pastoris, S. cerevisiae):

    • Advantages: Eukaryotic protein processing, higher chance of correct folding

    • Limitations: Lower yield than E. coli, longer cultivation time

    • Particularly suitable for structural and functional studies requiring proper folding

  • Plant-based expression systems:

    • Advantages: Native post-translational modifications, natural binding partners

    • Methods: Transient expression in Nicotiana benthamiana, stable transformation of Arabidopsis thaliana

    • Particularly valuable for interaction studies in the native cellular environment

For most biochemical characterizations, E. coli-expressed protein with >90% purity as determined by SDS-PAGE is suitable, while interaction studies may benefit from eukaryotic expression systems .

What purification strategy yields the highest purity of recombinant PRA1E?

A multi-step purification strategy is recommended to achieve high purity recombinant PRA1E:

  • Affinity chromatography (primary step):

    • For His-tagged PRA1E: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • Typical binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Elution strategy: Imidazole gradient (50-250 mM) to minimize co-purification of contaminants

  • Intermediate purification:

    • Ion exchange chromatography based on the theoretical pI of PRA1E

    • Size exclusion chromatography to separate aggregates and truncated products

  • Detergent considerations:

    • As a transmembrane protein, optimal purification may require detergents

    • Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG maintain native structure

    • Detergent exchange can be performed during size exclusion chromatography

  • Quality control:

    • SDS-PAGE analysis showing >90% purity

    • Western blot confirmation using anti-His and anti-PRA1E antibodies

    • Mass spectrometry to confirm intact mass and sequence coverage

This multi-step approach typically yields protein of sufficient purity for most biochemical and structural analyses.

How does PRA1E interact with Rab GTPases in Arabidopsis?

The interaction between PRA1E and Rab GTPases involves specific molecular mechanisms:

  • Interaction specificity:

    • PRA1 family proteins can promiscuously associate with various Rab GTPases

    • They show preference for endosomally localized Rabs

    • The interaction appears to be transient and may depend on the prenylation status of the Rab GTPases

  • Functional significance:

    • While PRA1 proteins have been proposed to function in Rab trafficking, in vivo evidence supporting this role has been inconsistent

    • Studies in yeast show that PRA1 homologs are non-essential, with no evident phenotype in the endosomal system

    • Alternative hypotheses suggest more structural roles within the early secretory pathway

  • Experimental approaches to study interactions:

    • Co-immunoprecipitation with specific Rab GTPases

    • Yeast two-hybrid screening

    • FRET-based interaction assays

    • Membrane-based proteomic approaches that account for the transmembrane nature of PRA1E

Recent unbiased screening approaches that account for the membrane association of PRA1 have failed to identify Rab GTPases as major binding partners, suggesting that the functional role of PRA1E may be more complex than previously thought .

What is the role of PRA1E in vesicular trafficking in plant cells?

PRA1E's role in vesicular trafficking appears to be multifaceted:

  • ER-Golgi trafficking:

    • The presence of both ER retention motifs and Golgi targeting signals suggests PRA1E may regulate trafficking between these compartments

    • Disruption of PRA1 family proteins leads to abnormal ER and Golgi phenotypes

  • Membrane contact sites:

    • Endogenous PRA1 family proteins have been found at ER-mitochondria membrane contact sites

    • This localization suggests potential roles in inter-organellar communication and lipid transfer

  • Experimental approaches to study trafficking function:

    • Cargo trafficking assays using model secretory proteins

    • Live cell imaging of fluorescently tagged vesicular markers

    • Electron microscopy to examine ultrastructural changes

    • Induced relocalization experiments to test functional consequences

  • Contextual considerations:

    • PRA1E function may be cell-type specific, with particularly important roles in specialized secretory cells

    • Environmental stresses may alter the trafficking function of PRA1E

The precise molecular mechanism by which PRA1E influences vesicular trafficking remains to be fully elucidated, with evidence pointing toward both direct regulatory roles and indirect structural functions within the secretory pathway.

How does PRA1E function differ from other members of the PRA1 family in Arabidopsis?

Arabidopsis contains multiple PRA1 family members with distinct functions:

  • Expression patterns:

    • AtPR1 (At2g14610) is activated by pathogens, insects, or chemical treatments

    • Other PR1-type genes are constitutively expressed in specific tissues like roots and pollen

    • PRA1E has its own unique expression profile that may correlate with its specialized function

  • Functional specialization:

    • Different PRA1 family members likely have tissue-specific roles

    • Some may be involved in general vesicular trafficking

    • Others, like PRA1E, may have more specialized functions in plant-specific processes

    • Functional redundancy may exist among closely related family members

  • Evolutionary considerations:

    • Comparative analysis of PRA1 family members across plant species reveals conservation of key functional domains

    • Species-specific expansions suggest adaptation to particular environmental challenges

  • Research approaches to distinguish functions:

    • Tissue-specific expression analysis

    • Phenotypic characterization of knockout/knockdown lines

    • Complementation studies between family members

    • Systematic interaction screening to identify unique binding partners

Understanding the functional divergence within the PRA1 family provides insight into how plants have evolved specialized trafficking machinery to meet diverse physiological needs.

How is PRA1E involved in plant immunity responses?

While direct evidence for PRA1E in immunity is still emerging, research on related proteins suggests potential involvement:

  • Secretory pathway regulation:

    • Plant immunity requires robust secretory pathway function for:

      • Antimicrobial protein secretion

      • Plasma membrane receptor trafficking

      • Cell wall reinforcement

    • As a regulator of vesicular trafficking, PRA1E may influence these processes

  • Connections to pathogenesis-related proteins:

    • Some PR1-type proteins in Arabidopsis have well-established immunity functions

    • These proteins undergo proteolytic processing dependent on their C-terminal motifs

    • Only properly processed variants are secreted to the apoplast

    • The released protein fragments modulate defense responses

  • Experimental approaches to study immunity roles:

    • Challenge of PRA1E-overexpressing or knockout lines with pathogens

    • Analysis of defense gene expression and immunity markers

    • Secretome analysis to identify differentially secreted defense proteins

    • Co-expression network analysis to identify immunity-related functional associations

The tissue-localized and ontogenesis-dependent nature of immunity functions observed for related proteins suggests that PRA1E's role may similarly be context-dependent .

How can researchers effectively study PRA1E in the context of Arabidopsis as a model organism?

Effective study of PRA1E in Arabidopsis requires careful experimental design:

  • Growth and cultivation considerations:

    • Use standardized growth conditions to ensure reproducible results

    • Surface-sterilize seeds and stratify for three days at 4°C for uniform germination

    • Maintain consistent light (typically 12h photoperiod) and temperature (19°C) conditions

    • Score germination at consistent timepoints (e.g., 5 days post-stratification)

  • Genetic manipulation approaches:

    • T-DNA insertion lines from stock centers (verify insertions by PCR)

    • CRISPR/Cas9 for precise gene editing

    • Transgenic overexpression using tissue-specific or inducible promoters

    • Fluorescent protein fusions for localization studies

  • Phenotypic analysis:

    • Developmental assessments at multiple growth stages

    • Stress response characterization (biotic and abiotic)

    • Subcellular phenotyping using appropriate microscopy techniques

    • Biochemical analysis of secretory pathway function

  • Integration with other techniques:

    • Transcriptomics to identify co-regulated genes

    • Proteomics to identify interaction partners

    • Metabolomics to identify downstream effects on plant physiology

Arabidopsis offers numerous advantages for studying PRA1E including its small size, fast generation time, and extensive genetic resources, making it ideal for comprehensive functional characterization .

What are the challenges and solutions for crystallizing PRA1E for structural studies?

Structural studies of transmembrane proteins like PRA1E present specific challenges:

  • Challenges in crystallization:

    • Multiple transmembrane domains create hydrophobic surfaces

    • Proper folding requires lipid or detergent environments

    • Conformational flexibility may impede crystal formation

    • Low natural abundance requires recombinant expression

  • Optimization strategies:

    • Construct optimization: Create truncations or fusion constructs to enhance stability

    • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) for optimal extraction

    • Lipidic cubic phase (LCP) crystallization for membrane proteins

    • Co-crystallization with antibody fragments or binding partners to stabilize structure

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) for detergent-solubilized protein

    • Nuclear magnetic resonance (NMR) for structural dynamics

    • Molecular dynamics simulations based on homology models

    • Crosslinking mass spectrometry to identify spatial relationships between domains

  • Expression strategies for structural studies:

    • Insect cell expression for improved folding

    • Use of fusion partners like SUMO or MBP to enhance solubility

    • Isotopic labeling for NMR studies

These approaches can overcome the inherent difficulties in obtaining structural information for complex transmembrane proteins like PRA1E.

How can researchers investigate the dynamic trafficking of PRA1E between cellular compartments?

Investigating dynamic trafficking requires specialized techniques:

  • Live cell imaging approaches:

    • Photoactivatable or photoconvertible fluorescent protein fusions

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Pulse-chase imaging with conditional fluorescent reporters

    • Super-resolution live cell imaging for nanoscale dynamics

  • Biochemical tracking methods:

    • RUSH (Retention Using Selective Hooks) system for synchronized trafficking

    • Dynamic SILAC labeling to track protein movement through compartments

    • Induced relocalization using chemical or optogenetic approaches

    • Split-GFP complementation to visualize arrival at specific compartments

  • Trafficking perturbation strategies:

    • Temperature blocks to arrest trafficking at specific steps

    • Small molecule inhibitors of vesicular transport machinery

    • Dominant-negative constructs of trafficking regulators

    • Acute inactivation using auxin-inducible degradation

  • Analysis considerations:

    • Quantitative image analysis for trafficking kinetics

    • Mathematical modeling of steady-state distributions

    • Correlation with functional assays to determine significance

These approaches allow researchers to move beyond static snapshots of protein localization to understand the dynamic regulation of PRA1E trafficking in living cells.

How can researchers resolve expression and solubility issues with recombinant PRA1E?

When facing expression and solubility challenges with PRA1E:

  • Expression troubleshooting:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (BL21, Rosetta, C41/C43)

    • Vary induction conditions (temperature, IPTG concentration, duration)

    • Consider fusion partners (SUMO, MBP, TrxA) to enhance expression

    • Screen different media formulations (LB, TB, auto-induction)

  • Solubility enhancement:

    • Test expression at lower temperatures (16-20°C)

    • Add solubility enhancers to lysis buffer (glycerol, mild detergents)

    • Include stabilizing additives (trehalose, specific ions)

    • For membrane proteins, screen detergents systematically

    • Consider native-like membrane mimetics (nanodiscs, SMALPs)

  • Refolding strategies:

    • If inclusion bodies form, develop a refolding protocol

    • Use gradual dialysis to remove denaturants

    • Test additives that promote correct folding

    • Validate refolded protein functionality with activity assays

  • Quality control:

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to evaluate aggregation state

    • Thermal shift assays to assess stability

    • Functional assays to confirm biological activity

Systematic optimization of these parameters typically resolves most expression and solubility issues with challenging proteins like PRA1E.

What controls and validations are necessary for interpreting PRA1E localization experiments?

Rigorous controls are essential for accurate interpretation of PRA1E localization:

  • Antibody validation for immunolocalization:

    • Confirm specificity using knockout/knockdown lines

    • Test multiple antibodies targeting different epitopes

    • Include peptide competition controls

    • Validate using orthogonal techniques (e.g., fluorescent protein fusions)

  • Fusion protein controls:

    • Compare N- and C-terminal fusions as they may localize differently

    • Verify functionality of fusion proteins

    • Use multiple fluorescent proteins to rule out tag-specific artifacts

    • Compare overexpression vs. endogenous expression levels

  • Compartment marker validation:

    • Use multiple independent markers for each compartment

    • Include positive controls for colocalization analysis

    • Employ super-resolution techniques for precise spatial relationships

    • Perform serial section electron microscopy for ultrastructural confirmation

  • Quantitative analysis:

    • Use appropriate statistical methods for colocalization quantification

    • Collect sufficient biological and technical replicates

    • Account for cell-to-cell variability

    • Apply consistent thresholding and analysis parameters

These controls and validations ensure that observed PRA1E localization patterns reflect biological reality rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.