Recombinant Arabidopsis thaliana PRA1 family protein F2 (PRA1F2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vesicle Trafficking

PRA1F2 regulates secretory and endocytic pathways by interacting with Rab GTPases and SNARE proteins, facilitating vesicle docking and membrane fusion . It localizes to the endoplasmic reticulum (ER), Golgi apparatus, and endosomal/prevacuolar compartments, suggesting roles in both anterograde and retrograde transport .

Key Functional Insights:

  • Dimerization: PRA1F2 forms homodimers and heterodimers with other AtPRA1 family members (e.g., PRA1A2, PRA1H) .

  • Coexpression Networks: Transcriptomic data reveal coexpression with Rab GTPases (e.g., RABG3A) and vesicle transport proteins .

  • Stress Response: While not directly linked to osmotic stress, PRA1F2’s interaction partners (e.g., BPA1, ACD11) are implicated in stress-related signaling .

Table 2: Predicted Interaction Partners of PRA1F2

Partner ProteinFunctionInteraction Score
PRA1A2Vesicle trafficking in endosomal compartments0.893
RABG3ARegulation of intracellular vesicle transport0.773
ACD11Ceramide-1-phosphate transport; cell death regulation0.630

Recombinant Production and Applications

Recombinant PRA1F2 is commercially produced for research, with protocols optimized for high yield in E. coli . Key applications include:

  • Biochemical Assays: Studying Rab GTPase binding kinetics .

  • Structural Studies: Investigating membrane protein dynamics .

  • Plant Cell Biology: Elucidating vesicle trafficking mechanisms in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRA1F2; PRA7; At1g55190; F7A10.20; PRA1 family protein F2; AtPRA1.F2; Prenylated Rab acceptor 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1F2
Target Protein Sequence
MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISR IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID DRTVLIGLSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAAVTEA SGLMSYPSS
Uniprot No.

Target Background

Function
This protein may be involved in both secretory and endocytic intracellular trafficking within the endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT1G55190

STRING: 3702.AT1G55190.1

UniGene: At.66851

Protein Families
PRA1 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hypocotyls and trichomes.

Q&A

What is the structural organization and subcellular localization of PRA1F2?

PRA1F2 is a small transmembrane protein that shares structural characteristics with other PRA1 family members. Key structural features include:

  • Conserved secretory signal sequences

  • Multiple transmembrane domains

  • Four consensus N-glycosylation sites

  • Seven conserved cysteine residues that likely contribute to tertiary structure

  • A zinc-binding domain that suggests potential proteolytic activity

Subcellular localization studies suggest that PRA1 family proteins are primarily associated with endomembrane systems. Different PRA1 members localize to specific compartments along the secretory pathway. While the exact localization of PRA1F2 hasn't been definitively determined in all search results, related family members such as AtPRA1.B6 localize to the Golgi apparatus, while others like OsPRA1 are found in prevacuolar compartments .

The protein is heavily glycosylated, with N-linked carbohydrate chains accounting for approximately 25% of the molecular weight, explaining why the apparent molecular weight (~50-60 kDa) significantly exceeds the predicted size of 31 kDa .

How can recombinant PRA1F2 be expressed and purified for experimental use?

The recombinant production of PRA1F2 typically follows these methodological steps:

  • Vector Construction: The PRA1F2 coding region (1-189 amino acids) can be amplified using PCR with primers designed to introduce appropriate restriction sites. For example, one successful approach used primers to introduce a BglII site at position -1 and an XhoI site at the 3' end .

  • Expression System Selection: E. coli is the most common expression system for PRA1F2 . The protein can be expressed with an N-terminal His-tag to facilitate purification.

  • Protein Expression: Transform the construct into a suitable E. coli strain and induce protein expression under optimized conditions.

  • Purification Protocol:

    • Harvest cells and lyse using appropriate buffer

    • Purify using Ni-NTA or similar affinity chromatography for His-tagged protein

    • Perform additional purification steps if higher purity is required

    • Dialyze against storage buffer containing Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Quality Control: The purity should be verified by SDS-PAGE (typically >90% purity) .

  • Storage and Handling:

    • Store the purified protein at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

What experimental design approaches are most effective for studying PRA1F2 function?

When designing experiments to study PRA1F2 function, researchers should consider these key methodological principles:

  • Define the Problem: Clearly articulate the specific aspects of PRA1F2 function you aim to investigate (e.g., interaction partners, role in vesicular transport, or contribution to plant immunity) .

  • Conduct Preliminary Analysis:

    • Literature survey on PRA1 family proteins

    • Sequence analysis for conserved domains and motifs

    • Perform phylogenetic analysis to understand relationships with other PRA1 members

  • Variable Selection: Apply dimensional analysis to select the most critical variables for measurement, potentially reducing experimental complexity .

  • Test Matrix Design: Instead of varying one parameter at a time, consider designed experiments with simultaneous parameter variation:

    • For full factorial analysis: If studying P parameters at L levels each, plan for N=L^P experimental runs

    • For complex studies, consider Taguchi's designed experiments to reduce the required number of experimental runs

  • Experimental Controls:

    • Use wild-type Arabidopsis as a baseline control

    • Consider generating PRA1F2 null mutants for comparative studies

    • Express PRA1F2 in heterologous systems (e.g., S. cerevisiae) to isolate protein function

  • Data Analysis Planning:

    • Statistical methods for analyzing results (e.g., Student's t-test, with results considered significant at P<0.05)

    • Include replication for robust statistical analysis

A well-designed experimental approach should incorporate both in vivo studies using Arabidopsis plants and in vitro studies with recombinant protein to comprehensively characterize PRA1F2 function.

How does PRA1F2 contribute to vesicular transport mechanisms?

PRA1F2, like other PRA1 family proteins, plays a crucial role in the regulation of vesicular transport through several mechanisms:

  • Rab GTPase Interaction: PRA1F2 functions as a receptor for Rab GTPases, which are master regulators of membrane trafficking. It primarily affects the membrane localization of Rab proteins by interacting with GDP dissociation inhibitors (GDIs) .

  • Membrane Transport Facilitation: By promoting the transport of small GTPases through the intimal system, PRA1F2 contributes to the directional movement of vesicles between cellular compartments .

  • Compartment-Specific Functions: While the exact compartmental specificity of PRA1F2 isn't fully characterized in the search results, related family members show distinct localizations:

    • AtPRA1.B6 localizes to the Golgi apparatus and participates in protein transport

    • OsPRA1 localizes to the prevacuolar compartment and interacts with OsRab7 to regulate vacuolar transport

  • Regulatory Mechanisms: The protein's activity appears to be regulated by environmental factors such as pH, suggesting context-dependent functions in membrane trafficking .

Research methodologies to further investigate these mechanisms could include:

  • Fluorescently tagged PRA1F2 to track subcellular localization

  • Co-immunoprecipitation studies to identify interaction partners

  • Vesicle trafficking assays in the presence and absence of functional PRA1F2

  • Yeast two-hybrid screens to map interaction domains with Rab GTPases

What is the relationship between pH regulation and PRA1F2 expression?

PRA1F2 expression demonstrates significant pH-dependent regulation, which may be critical to its biological function:

  • pH-Dependent Expression Pattern:

    • Northern blot analysis reveals that PRA1 transcript expression is strongly influenced by ambient pH

    • The transcript is detected in cells grown at pH 6.8 but not at pH 4.5, regardless of temperature or cell morphology

    • Maximal expression occurs around pH 7.0, with no detectable expression at pH 4.0 or 5.0

  • Temporal Expression Dynamics:

    • Expression is not immediately responsive to pH changes

    • The transcript is not detectable for the first 3 hours following inoculation into permissive pH medium

    • Expression is not detected in rich medium (YPD) even when buffered at pH 7.0

  • Complex Regulation:

    • pH is necessary but not sufficient for expression

    • Other factors, potentially including nutrient availability, also influence expression

    • The delayed expression in some media suggests potential involvement of secondary signaling mechanisms

  • Experimental Approaches for Further Study:

    • Use of reporter constructs fused to the PRA1F2 promoter to quantify expression under various conditions

    • Mutational analysis of promoter elements to identify pH-responsive regions

    • Transcription factor binding studies to identify regulatory proteins involved in pH response

    • Comparative analysis with other pH-regulated genes to identify common regulatory pathways

The pH-dependent expression suggests PRA1F2 may have specialized functions in specific microenvironments within the plant or during particular developmental or stress conditions associated with pH changes.

What genetic approaches can be used to study PRA1F2 function in Arabidopsis?

Several genetic approaches can be employed to study PRA1F2 function in Arabidopsis:

  • Null Mutant Generation and Analysis:

    • Deletion-disruption strategy can be implemented as demonstrated in similar studies

    • CRISPR/Cas9 gene editing allows for targeted mutagenesis

    • Phenotypic analysis of null mutants can reveal the protein's role in development, stress responses, and immunity

  • Overexpression Studies:

    • Constitutive expression using promoters like ADH or 35S

    • Tissue-specific overexpression to study compartmentalized functions

    • Phenotypic and molecular analysis of overexpression lines can reveal gain-of-function effects

  • Reporter Gene Fusion:

    • Promoter-reporter constructs to study expression patterns

    • Protein-reporter fusions (e.g., GFP) to visualize subcellular localization and trafficking

  • F2 Population Analysis:

    • Cross PRA1F2 mutants with different Arabidopsis accessions to create F2 populations

    • Analyze recombination frequencies and segregation patterns

    • Map genetic interactions through QTL analysis

  • Recombinant Inbred Line (RIL) Analysis:

    • Create RILs by crossing different accessions and selfing for multiple generations

    • These stable lines allow repeated studies under different environmental conditions

    • Particularly useful for mapping complex traits that might be influenced by PRA1F2

  • MAGIC (Multiparent Advanced Generation Inter-Cross) Population Analysis:

    • Utilize existing MAGIC lines derived from diverse Arabidopsis accessions

    • RNA-seq analysis of these lines can provide insights into natural variation in PRA1F2 expression

    • Allows dissection of complex genetic interactions

The choice of genetic approach depends on the specific research question, available resources, and the potential for genetic redundancy within the PRA1 family.

How can researchers analyze potential functional redundancy between PRA1F2 and other PRA1 family proteins?

Analyzing functional redundancy between PRA1F2 and other PRA1 family members requires a systematic approach:

  • Phylogenetic Analysis:

    • Construct evolutionary trees based on amino acid sequences of all PRA1 family proteins

    • The PRA1 family in Arabidopsis is divided into eight groups (subfamilies A through H)

    • PRA1F2 belongs to the F subfamily, which has distinctive evolutionary relationships with other groups

    • Identify the most closely related family members for focused redundancy studies

  • Expression Pattern Comparison:

    • Compare tissue-specific, developmental, and stress-responsive expression patterns

    • Use publicly available transcriptome data and conduct qRT-PCR validation

    • Analyze co-expression patterns to identify potentially redundant family members

  • Multiple Mutant Generation and Analysis:

    • Create single, double, and higher-order mutants of PRA1F2 and closely related family members

    • Phenotypic comparison between single and multiple mutants can reveal redundancy

    • Complementation assays can determine if one family member can functionally replace another

  • Domain Swapping Experiments:

    • Create chimeric proteins with domains exchanged between PRA1F2 and other family members

    • Express these under the PRA1F2 promoter in pra1f2 mutant backgrounds

    • Assess functional complementation to identify critical domains for specific functions

  • Interactome Analysis:

    • Compare the interaction partners of different PRA1 family members

    • Shared interactors suggest potential functional overlap

    • Unique interactors highlight specialized functions

  • Subcellular Localization Comparison:

    • Determine the precise localization of PRA1F2 and related family members

    • Co-localization suggests potential functional redundancy

    • Distinct localization patterns indicate specialized functions in different cellular compartments

This multi-faceted approach will provide comprehensive insights into the extent of functional redundancy within the PRA1 family and help identify the unique roles of PRA1F2.

What methods are most effective for identifying and characterizing PRA1F2 interaction partners?

To comprehensively identify and characterize PRA1F2 interaction partners, researchers can employ several complementary approaches:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use PRA1F2 as bait to screen Arabidopsis cDNA libraries

    • Verify positive interactions through directed Y2H assays

    • Consider using split-ubiquitin Y2H for membrane protein interactions, as PRA1F2 is a transmembrane protein

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged versions of PRA1F2 in Arabidopsis or heterologous systems

    • Precipitate protein complexes using tag-specific antibodies

    • Identify interacting partners by mass spectrometry

    • Validate interactions by reciprocal Co-IP

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse PRA1F2 and candidate interactors to complementary fragments of a fluorescent protein

    • Co-express in plant cells and visualize interactions through fluorescence microscopy

    • This approach provides spatial information about where in the cell interactions occur

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse PRA1F2 to a biotin ligase

    • Express in planta and identify biotinylated proteins by streptavidin pulldown and mass spectrometry

    • Particularly useful for identifying transient or weak interactions

  • In vitro Binding Assays:

    • Express and purify recombinant PRA1F2 using protocols outlined in section 2.1

    • Perform GST pulldown or similar binding assays with candidate interactors

    • Quantify binding affinities using techniques like surface plasmon resonance

  • Genetic Interaction Screens:

    • Cross pra1f2 mutants with mutants of candidate interacting genes

    • Analyze double mutants for synergistic or suppressive phenotypes

    • Use synthetic lethality as an indicator of functional relationships

  • Microscopy-Based Approaches:

    • Co-localization studies using fluorescently tagged proteins

    • Fluorescence resonance energy transfer (FRET) to detect direct protein interactions

    • Single-molecule tracking to monitor dynamic interactions

The information from these complementary approaches should be integrated to build a comprehensive interactome map for PRA1F2, with particular attention to interactions with Rab GTPases, which are known partners of PRA1 family proteins .

How can researchers investigate the role of PRA1F2 in plant immunity pathways?

Recent research indicates PRA1 family proteins are involved in plant immunity . To investigate PRA1F2's specific role in these pathways, researchers should consider these approaches:

  • Pathogen Challenge Experiments:

    • Compare responses of wild-type, pra1f2 knockout, and PRA1F2-overexpressing plants to various pathogens

    • Measure disease symptoms, pathogen growth, and induction of defense markers

    • Test responses to different pathogen classes (bacteria, fungi, oomycetes, viruses) to determine specificity

  • Pattern-Recognition Receptor (PRR) Trafficking Analysis:

    • Given that SlPRA1A affects PRR trafficking , investigate whether PRA1F2 similarly influences PRR localization

    • Use fluorescently tagged PRRs to monitor their trafficking in wild-type versus pra1f2 mutant backgrounds

    • Perform co-localization studies with markers for different endomembrane compartments

  • Defense Signaling Pathway Analysis:

    • Measure activation of immune signaling components (MAPK cascades, calcium signaling, reactive oxygen species)

    • Analyze defense hormone (salicylic acid, jasmonic acid, ethylene) accumulation and signaling

    • Perform transcriptome analysis to identify defense genes regulated by PRA1F2

  • Rab GTPase-Immunity Connection:

    • Identify which Rab GTPases interact with PRA1F2

    • Create dominant-negative or constitutively active Rab mutants to manipulate specific trafficking pathways

    • Determine how these manipulations affect immune responses in the presence/absence of functional PRA1F2

  • Secretion and Endocytosis Assays:

    • Analyze the secretion of antimicrobial compounds and cell wall reinforcement materials

    • Monitor endocytosis of PRRs and other plasma membrane proteins during immune responses

    • Compare these processes between wild-type and pra1f2 mutant plants

  • Subcellular Reorganization During Immune Responses:

    • Track changes in endomembrane organization during pathogen attack

    • Compare reorganization patterns between wild-type and pra1f2 mutant plants

    • Focus particularly on compartments where PRA1F2 localizes

  • Immune-Related Protein Stability Analysis:

    • Investigate whether PRA1F2 affects the stability of immune components

    • Perform protein degradation assays in the presence/absence of functional PRA1F2

    • Similar to how SlPRA1A regulates RLP-PRR degradation

These approaches will help elucidate PRA1F2's specific role in plant immunity and determine whether it functions similarly to other PRA1 family members in regulating defense responses.

How can comparative genomics enhance our understanding of PRA1F2 evolution and function?

Comparative genomics offers powerful approaches to understand PRA1F2's evolution and functional conservation:

  • Cross-Species PRA1 Family Analysis:

    • Compare PRA1 family members across diverse plant species, from mosses to angiosperms

    • Determine when the PRA1F subfamily emerged during plant evolution

    • Identify core conserved features versus lineage-specific innovations

  • Synteny Analysis:

    • Examine genomic regions surrounding PRA1F2 orthologs in different species

    • Identify conserved gene clusters that might suggest functional relationships

    • Track chromosomal rearrangements that have occurred during evolution

  • Selection Pressure Analysis:

    • Calculate Ka/Ks ratios (nonsynonymous/synonymous substitution rates) to identify domains under purifying or positive selection

    • Compare selection pressures across different plant lineages or ecological niches

    • Correlate selection patterns with known functional domains

  • Natural Variation Studies:

    • Analyze PRA1F2 sequence and expression variation across Arabidopsis accessions

    • Use resources like the 1001 Genomes Project to identify polymorphisms

    • Correlate variation with ecological factors or phenotypic differences

    • Utilize MAGIC lines and their RNA-seq data to study expression variation

  • Ancestral Sequence Reconstruction:

    • Infer ancestral PRA1F2 sequences at key evolutionary nodes

    • Express and characterize these reconstructed proteins

    • Identify gained or lost functions during evolution

  • Co-evolution Analysis:

    • Identify proteins that show correlated evolutionary patterns with PRA1F2

    • These may represent functional partners or participants in the same pathways

    • Focus particularly on Rab GTPases, which are known interactors of PRA1 proteins

  • Domain Architecture Comparison:

    • Compare the arrangement of functional domains across PRA1 family members

    • Identify unique domain combinations that might explain functional specialization

    • Engineer chimeric proteins to test domain functions

This comprehensive comparative genomics approach can provide insights into how PRA1F2 evolved its specific functions and how these functions might vary across different plant species or environmental conditions.

What are the most promising future research directions for understanding PRA1F2 function in plant development and stress responses?

Several promising research directions could significantly advance our understanding of PRA1F2:

  • Systems Biology Approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data to place PRA1F2 in broader cellular networks

    • Develop computational models of vesicular trafficking incorporating PRA1F2 function

    • Use network analysis to identify key hubs and bottlenecks in PRA1F2-related pathways

  • Single-Cell Analysis:

    • Apply single-cell RNA-seq to determine cell type-specific expression patterns

    • Identify potential specialized functions in specific tissues or developmental stages

    • Compare expression dynamics across different environmental conditions

  • Structural Biology:

    • Determine the three-dimensional structure of PRA1F2 alone and in complex with interacting partners

    • Focus on understanding how PRA1F2 binds to Rab GTPases and other interaction partners

    • Use structure-guided mutagenesis to test functional hypotheses

  • Environmental Response Mechanisms:

    • Given the pH-dependent expression of PRA1 genes , systematically investigate PRA1F2's role in responses to:

      • Soil pH changes

      • Pathogen attack

      • Nutrient availability

      • Abiotic stresses (drought, salinity, temperature)

  • Developmental Regulation:

    • Detailed characterization of PRA1F2 expression throughout plant development

    • Phenotypic analysis of pra1f2 mutants across different developmental stages

    • Investigation of potential roles in cell expansion, differentiation, or organ formation

  • Translational Research:

    • Explore the potential for manipulating PRA1F2 expression to enhance stress tolerance

    • Investigate conservation of function in crop species

    • Develop biotechnological applications based on PRA1F2's role in vesicular trafficking

  • Advanced Imaging Technologies:

    • Apply super-resolution microscopy to track PRA1F2-mediated vesicular transport in living cells

    • Use correlative light and electron microscopy to connect dynamic processes with ultrastructural details

    • Develop biosensors to monitor PRA1F2 activity in real-time

  • Synthetic Biology Approaches:

    • Design and test synthetic vesicular trafficking systems incorporating PRA1F2

    • Engineer PRA1F2 variants with novel functionalities

    • Create orthogonal trafficking pathways for biotechnological applications

These research directions leverage cutting-edge technologies and approaches to build a comprehensive understanding of PRA1F2's multifaceted roles in plant biology, potentially leading to applications in agriculture and biotechnology.

What are the main technical challenges in working with recombinant PRA1F2 and how can they be overcome?

Researchers working with recombinant PRA1F2 face several technical challenges:

  • Protein Solubility Issues:

    • Challenge: As a transmembrane protein, PRA1F2 can be difficult to express in soluble form.

    • Solutions:

      • Use specialized expression vectors designed for membrane proteins

      • Express truncated versions lacking transmembrane domains for solubility studies

      • Include detergents or lipid nanodisc systems during purification

      • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Proper Folding and Post-Translational Modifications:

    • Challenge: E. coli expression systems may not correctly process plant glycoproteins.

    • Solutions:

      • Consider eukaryotic expression systems (yeast, insect cells, or plant-based)

      • Use endoglycosidase H treatment to analyze glycosylation patterns

      • Verify protein functionality through activity assays

  • Protein Stability:

    • Challenge: Purified PRA1F2 may have limited stability.

    • Solutions:

      • Optimize buffer conditions (pH, ionic strength, additives)

      • Include 5-50% glycerol in storage buffer

      • Store as aliquots at -80°C to avoid freeze-thaw cycles

      • Use lyophilization for long-term storage

  • Functional Assays:

    • Challenge: Developing assays that accurately measure PRA1F2 activity.

    • Solutions:

      • Design Rab GTPase binding assays based on known interactions of PRA1 proteins

      • Develop reconstituted vesicle trafficking systems

      • Use microscopy-based trafficking assays in cells

  • Structural Analysis:

    • Challenge: Obtaining structural information on transmembrane proteins.

    • Solutions:

      • Use cryo-electron microscopy instead of X-ray crystallography

      • Apply NMR techniques optimized for membrane proteins

      • Consider computational structure prediction approaches

  • Protein-Protein Interaction Analysis:

    • Challenge: Accurately capturing native membrane protein interactions.

    • Solutions:

      • Use membrane-based yeast two-hybrid systems

      • Apply proximity labeling approaches (BioID, APEX)

      • Develop native membrane extraction protocols that preserve interactions

  • Expression Level Optimization:

    • Challenge: Achieving sufficient expression levels for experimental use.

    • Solutions:

      • Optimize codon usage for the expression system

      • Test multiple promoter systems

      • Explore different induction conditions (temperature, inducer concentration, timing)

      • Screen multiple expression strains

By systematically addressing these challenges, researchers can improve the quality and yield of recombinant PRA1F2 for functional and structural studies.

How can researchers analyze and interpret contradictory data when studying PRA1F2 function?

When confronted with contradictory data regarding PRA1F2 function, researchers should apply these methodological approaches:

  • Systematic Validation through Multiple Techniques:

    • Verify findings using independent methodological approaches

    • For example, if protein interaction results differ between Y2H and Co-IP, validate with a third method like BiFC

    • Use both in vitro and in vivo approaches to confirm observations

  • Experimental Condition Analysis:

    • Consider how differences in experimental conditions might explain contradictory results:

      • pH conditions (given PRA1F2's pH-dependent expression)

      • Growth stage of plants

      • Tissue-specific effects

      • Environmental variables

  • Genetic Background Considerations:

    • Assess whether contradictions arise from differences in:

      • Arabidopsis accessions used (genetic background effects)

      • T-DNA insertion positions in mutant lines

      • Presence of second-site mutations

      • Test hypotheses in multiple genetic backgrounds

  • Experimental Design Optimization:

    • Apply principles of robust experimental design:

      • Implement full factorial analysis where appropriate

      • Use Taguchi's designed experiments to efficiently test multiple parameters

      • Calculate required sample sizes for adequate statistical power

  • Statistical Analysis Refinement:

    • Apply appropriate statistical methods:

      • Consider whether parametric or non-parametric tests are appropriate

      • Use statistical significance threshold of P<0.05

      • Implement multiple test corrections for genome-wide studies

      • Consider Bayesian approaches for complex datasets

  • Genetic Redundancy Assessment:

    • Determine if contradictions stem from functional redundancy among PRA1 family members

    • Create and analyze higher-order mutants

    • Use conditional or tissue-specific knockdown approaches

  • Literature-Based Meta-Analysis:

    • Systematically compare methodologies across published studies

    • Identify patterns in contradictory results that might suggest underlying biological complexity

    • Develop integrative models that accommodate seemingly contradictory observations

  • Collaborative Resolution:

    • Engage with other laboratories reporting contradictory results

    • Exchange materials, protocols, and data

    • Design joint experiments to resolve discrepancies

  • Publication of Negative or Contradictory Results:

    • Document and publish well-designed experiments even when they contradict existing literature

    • Include detailed methodological information to enable replication

    • Discuss potential reasons for contradictions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.