Recombinant Arabidopsis thaliana PRA1 family protein F3 (PRA1F3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana PRA1 Family Protein F3 (PRA1F3)

Recombinant PRA1F3 is a full-length protein derived from Arabidopsis thaliana, encoded by the gene PRA1F3 (At3g13720). It belongs to the PRA1 family, which regulates intracellular vesicle trafficking by interacting with Rab GTPases and SNARE complexes. PRA1F3 is expressed in vascular tissues, guard cells, and developing organs, and localizes to the trans-Golgi network (TGN), tonoplasts, and prevacuolar compartments . Its recombinant forms are produced in E. coli, yeast, or mammalian systems, often with N-terminal His-tags or biotinylated AviTags for purification .

Protein Characteristics

ParameterDetailsSource
Gene LocusAt3g13720
UniProt IDQ9LIC6
Protein LengthFull-length (1–188 amino acids)
Expression SystemsE. coli, yeast, mammalian cells, baculovirus
TagsN-terminal His-tag, AviTag (biotinylated)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage Conditions-20°C/-80°C (long-term), 4°C (short-term aliquots)

Molecular Interactions

PRA1F3 interacts with Rab5/Rab7 GTPases and SNARE complexes (e.g., SYP21/22, VTI11/12, VAMP711/713) to regulate vacuolar protein trafficking . It does not bind GDP dissociation inhibitors (GDIs), suggesting it directly recruits Rab proteins to membranes .

Subcellular Localization

  • Trans-Golgi network (TGN): Mediates post-Golgi vacuolar trafficking .

  • Tonoplasts: Involved in vacuole membrane dynamics .

  • Endosomes/prevacuolar compartments: Linked to endocytic pathways .

Physiological Roles

FunctionEvidenceSource
Vacuolar traffickingOverexpression disrupts aleurain-GFP and sporamin-GFP trafficking to vacuoles
Salt homeostasisKnockout plants show abnormal vesicles in the TGN and salt sensitivity
Membrane organizationMaintains TGN integrity; knockout causes swollen vesicles

Production and Purification

Recombinant PRA1F3 is produced via heterologous expression systems:

  1. E. coli: Yields His-tagged proteins with >90% purity, suitable for biochemical assays .

  2. Yeast/Mammalian systems: Used for post-translational modifications (e.g., N-glycosylation) .

  3. AviTag-Biotin technology: Enables biotinylated proteins for affinity-based assays .

Purification Steps:

  • Ni-NTA affinity chromatography (His-tagged) .

  • SDS-PAGE validation for purity .

  • Lyophilization for long-term storage .

Vacuolar Trafficking Studies

PRA1F3 overexpression/knockout models reveal its role in:

  • Cargo sorting: Affects transport of storage proteins (aleurain, sporamin) but not secretory proteins (invertase, PR1) .

  • Membrane remodeling: Regulates TGN morphology and vacuole formation .

Salt Stress Responses

PRA1F3-deficient plants exhibit:

  • Abnormal TGN vesicles: Linked to impaired salt homeostasis .

  • Reduced lipid absorption: Analogous to PRAP1’s role in lipid transport (though distinct mechanisms) .

Challenges and Future Directions

  • Structural studies: Limited 3D data; requires cryo-EM or X-ray crystallography .

  • Functional redundancy: Overlap with other PRA1 family members necessitates gene-specific analysis .

  • Therapeutic potential: Insights into vacuolar trafficking could inform plant stress resilience strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipment is preferred, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRA1F3; PRA8; At3g13720; MMM17.14; PRA1 family protein F3; AtPRA1.F3; Prenylated Rab acceptor 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1F3
Target Protein Sequence
MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETS GLTSYPST
Uniprot No.

Target Background

Function
This protein may be involved in both secretory and endocytic intracellular trafficking within the endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT3G13720

STRING: 3702.AT3G13720.1

UniGene: At.23301

Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in lateral roots, lateral root caps and columella cells.

Q&A

What is PRA1F3 and what is its fundamental role in Arabidopsis thaliana?

PRA1F3 (Prenylated Rab Acceptor 1 Family Protein F3) is a member of the PRA1 protein family in Arabidopsis thaliana. This protein plays a pivotal role in the endomembrane system, specifically in vacuolar protein transport. The endomembrane system consists of a dynamic set of membrane-bounded organelles that function in cellular homeostasis and maintenance . PRA1F3 is involved in the trafficking processes between these organelles, which occurs through vesicles that directionally transfer proteins and other cargo molecules .

At a molecular level, PRA1F3 (also known as AtPRA1.F3) acts as a recruiter of prenylated Rab proteins onto specific compartment membranes, which is a critical step in vesicle trafficking . The gene is located at locus At3g13720 in the Arabidopsis genome, with ORF name MMM17.14 . Understanding PRA1F3's role is significant because proper vacuolar protein transport is essential for numerous plant physiological processes, including growth, development, and stress responses.

What protein interactions are associated with PRA1F3 function?

Research has identified several key interactors of PRA1F3 through co-immunoprecipitation (Co-IP) assays and split ubiquitin yeast two-hybrid (SU-Y2H) assays . The major protein interactions include:

Protein CategorySpecific InteractorsAssociated Function
Rab GTPasesRabG3eVacuolar trafficking
Rab FamilyRabF/Rab5 membersEndosomal maturation
Rab FamilyRabG/Rab7 membersLate endosome to vacuole trafficking
SNARE ProteinsSYP21/22-SYP51/52-VTI11/12 complexesMembrane fusion events

These interactions suggest that PRA1F3 functions as a connector between Rab GTPases and SNARE proteins in the vesicle trafficking machinery . The interaction with RabF/Rab5 and RabG/Rab7 protein families is particularly significant, as these proteins drive endosomal maturation, a critical process in protein sorting and transport to the vacuole. The interaction with SNAREs further indicates PRA1F3's involvement in membrane fusion events during vesicle trafficking.

What experimental approaches are most effective for studying PRA1F3 function?

Several experimental approaches have proven valuable for investigating PRA1F3 function in Arabidopsis thaliana. Based on previous research, the following methodologies are particularly effective:

  • Protein-Protein Interaction Studies: Co-immunoprecipitation (Co-IP) and split ubiquitin yeast two-hybrid (SU-Y2H) assays have successfully identified PRA1F3 interactors, including Rab proteins and SNAREs . These techniques can be further exploited to dissect the specific binding domains and interaction dynamics.

  • Subcellular Localization: Fluorescent protein tagging combined with confocal microscopy enables visualization of PRA1F3 within the endomembrane system. This approach can be complemented with co-localization studies using markers for different compartments (endosomes, Golgi, vacuole).

  • Genetic Manipulation: T-DNA insertion lines and CRISPR-Cas9 gene editing have been employed to create pra1f3 knockout or knockdown mutants, allowing for functional analysis through phenotypic characterization and rescue experiments.

  • Vesicle Trafficking Assays: Monitoring the transport of fluorescently-tagged vacuolar cargo proteins in wild-type versus pra1f3 mutant backgrounds can reveal specific defects in trafficking pathways.

  • Biochemical Fractionation: Membrane fractionation techniques combined with western blotting can determine the precise subcellular compartment where PRA1F3 resides and functions.

These approaches should be used in combination to develop a comprehensive understanding of PRA1F3's role in vacuolar protein transport and its integration within the broader endomembrane trafficking network .

How does PRA1F3 mediate specificity in vacuolar protein transport?

PRA1F3 exhibits specificity in vacuolar protein transport through several mechanisms that regulate the targeting and delivery of cargo proteins to the vacuole. The specificity is achieved through:

  • Selective Rab Protein Interactions: PRA1F3 interacts with specific members of the RabF/Rab5 and RabG/Rab7 families, which are involved in distinct stages of endosomal maturation and vacuolar targeting . This selective interaction ensures that only appropriate vesicles are directed toward the vacuole.

  • SNARE Complex Formation: PRA1F3 interaction with specific SNARE proteins (SYP21/22-SYP51/52-VTI11/12) guides the formation of fusion-competent SNARE complexes at the appropriate membrane interfaces . This specificity in SNARE pairing ensures that vesicles fuse only with their intended target membranes.

  • Cargo Recognition: While not directly binding cargo proteins, PRA1F3 likely functions within a larger machinery that recognizes vacuolar sorting signals on cargo proteins, ensuring that only proteins destined for the vacuole are included in specific transport vesicles.

  • Compartment Identity Maintenance: By recruiting specific Rab proteins to particular membrane domains, PRA1F3 contributes to maintaining the distinct identity of endomembrane compartments involved in the vacuolar trafficking pathway.

Research using fluorescently-tagged vacuolar cargo proteins has demonstrated that disruption of PRA1F3 function leads to mislocalization of vacuolar proteins, indicating its crucial role in maintaining the specificity of this transport pathway .

What is the evolutionary significance of PRA1F3 in plant vesicle trafficking?

The evolutionary significance of PRA1F3 in plant vesicle trafficking can be understood through several key aspects:

  • Conservation Across Plant Species: While the specific research focused on Arabidopsis thaliana, PRA1 family proteins are conserved across plant species, suggesting fundamental roles in plant cellular function that have been maintained throughout evolutionary history.

  • Specialization in Plants: Unlike their counterparts in yeast and mammals, the PRA1 family in Arabidopsis has expanded considerably, with PRA1F3 representing one specialized member of this larger family . This expansion suggests that plants have evolved more complex and specialized vesicle trafficking pathways.

  • Adaptation to Plant-Specific Structures: Plant cells contain unique compartments like the vacuole, which serves multiple functions including storage, degradation, and maintaining turgor pressure. PRA1F3's specialization in vacuolar trafficking represents an adaptation to these plant-specific cellular requirements.

  • Integration with Plant-Specific Processes: Evidence suggests that vesicle trafficking mediated by proteins like PRA1F3 may be involved in plant-specific processes such as responses to environmental stresses and pathogen defense . This integration highlights how fundamental cellular machinery has been adapted to plant-specific ecological challenges.

Comparative genomic analyses across the 1,135 sequenced Arabidopsis accessions have provided insights into genetic diversity that can inform our understanding of how proteins like PRA1F3 may vary across natural populations . This evolutionary perspective is crucial for understanding how vesicle trafficking machinery has been shaped by natural selection in different plant lineages and environments.

How can recombinant PRA1F3 be optimally expressed and purified for functional studies?

Optimal expression and purification of recombinant PRA1F3 requires specific methodological considerations due to its membrane-associated nature. Based on current research practices, the following protocol is recommended:

  • Expression System Selection:

    • E. coli: BL21(DE3) strains with pET vectors containing codon-optimized PRA1F3 sequence for proteins used in in vitro binding assays.

    • Yeast: Pichia pastoris for expression of properly folded membrane proteins with post-translational modifications.

    • Insect cells: Baculovirus expression system for complex membrane proteins requiring eukaryotic processing.

  • Construct Design:

    • Include an appropriate tag (His6, GST, or MBP) for purification, with a TEV protease cleavage site for tag removal.

    • Consider expressing specific domains separately if the full-length protein proves challenging.

    • For the complete sequence (188 amino acids), ensure proper incorporation of the transmembrane domains .

  • Solubilization and Purification:

    • Use mild detergents (DDM, LMNG, or digitonin) to solubilize membrane fractions.

    • Employ a two-step purification: affinity chromatography followed by size exclusion chromatography.

    • For functional studies, consider reconstitution into liposomes or nanodiscs to maintain native-like membrane environment.

  • Quality Control:

    • Confirm protein identity via mass spectrometry.

    • Assess protein folding using circular dichroism spectroscopy.

    • Verify functionality through in vitro binding assays with known interactors (Rab proteins).

This approach has been successfully applied to other prenylated Rab acceptor proteins and should be adaptable for PRA1F3, allowing for detailed biochemical and structural analyses to understand its mechanism of action in vesicle trafficking .

What genomic and transcriptomic approaches can reveal PRA1F3 regulation in different tissues and conditions?

Understanding the regulation of PRA1F3 at genomic and transcriptomic levels requires integrative approaches that can reveal expression patterns and regulatory mechanisms across different tissues and environmental conditions:

  • RNA-Seq Analysis:

    • Perform differential expression analysis of PRA1F3 across various tissues, developmental stages, and stress conditions.

    • Use time-course experiments to capture dynamic changes in expression during responses to environmental stimuli.

    • Compare expression patterns with other vesicle trafficking components to identify co-regulated gene modules.

  • ChIP-Seq Analysis:

    • Identify transcription factors binding to the PRA1F3 promoter region through chromatin immunoprecipitation.

    • Map histone modifications (H3K4me3, H3K27me3) at the PRA1F3 locus to understand epigenetic regulation .

    • Investigate if stress treatments alter the epigenomic landscape at the PRA1F3 locus, similar to those observed in other stress-responsive genes .

  • Promoter Analysis:

    • Create promoter-reporter fusions (PRA1F3promoter:GUS or PRA1F3promoter:LUC) to visualize tissue-specific expression patterns.

    • Perform deletion analysis of the promoter to identify critical regulatory elements.

    • Use yeast one-hybrid assays to identify transcription factors that bind to these elements.

  • Natural Variation Analysis:

    • Leverage the 1,135 sequenced Arabidopsis accessions to identify natural variation in PRA1F3 sequence and expression .

    • Conduct Genome-Wide Association Studies (GWAS) to link phenotypic variation in vesicle trafficking to genetic variants in or near PRA1F3.

    • Examine if variants in PRA1F3 correlate with adaptation to specific environmental conditions across the natural range of Arabidopsis.

These approaches can reveal how PRA1F3 expression is fine-tuned in different tissues and conditions, providing insights into its role in normal development and stress responses . The integration of these data with protein interaction studies will provide a comprehensive understanding of PRA1F3 function in plant cellular processes.

How can CRISPR-Cas9 genome editing be optimized for functional studies of PRA1F3?

CRISPR-Cas9 genome editing provides powerful tools for functional analysis of PRA1F3 in Arabidopsis thaliana. The following methodological approaches are recommended for optimal results:

  • Guide RNA Design:

    • Target multiple exons within the PRA1F3 gene (At3g13720) to ensure complete knockout.

    • Use Arabidopsis-specific CRISPR design tools to select guide RNAs with high on-target efficiency and minimal off-target effects.

    • Consider the following target criteria:

      • GC content between 40-60%

      • Minimal self-complementarity to avoid secondary structures

      • Target regions conserved across Arabidopsis accessions to ensure broad applicability

  • Vector Construction and Delivery:

    • For Arabidopsis transformation, use binary vectors compatible with Agrobacterium-mediated floral dip transformation.

    • Include appropriate selection markers (hygromycin or BASTA resistance) and screening reporters (such as seed-specific fluorescent markers).

    • Consider multiplex editing by including several guide RNAs in a single construct to increase knockout efficiency.

  • Mutation Verification and Characterization:

    • Perform targeted sequencing of the PRA1F3 locus to identify indels and frameshift mutations.

    • Verify knockout at the protein level using antibodies against PRA1F3 or epitope-tagged complementation lines.

    • Create a phenotypic profile comparing wild-type, heterozygous, and homozygous mutant plants under various conditions.

  • Advanced Genome Editing Applications:

    • Generate precise point mutations to study specific functional domains of PRA1F3.

    • Create epitope-tagged or fluorescent protein fusions at the endogenous locus for localization and interaction studies.

    • Implement conditional knockout systems (such as dexamethasone-inducible Cas9) to study PRA1F3 function at specific developmental stages.

  • Complementation and Rescue Experiments:

    • Transform knockout lines with the wild-type PRA1F3 sequence to verify phenotypic rescue.

    • Introduce modified versions of PRA1F3 (with altered interaction domains) to assess specific functions.

    • Use tissue-specific promoters to restrict PRA1F3 expression for understanding its role in specific cell types.

These CRISPR-based approaches can provide definitive evidence for PRA1F3 function in vacuolar protein transport and reveal potentially novel roles in plant development and stress responses .

What imaging techniques are most informative for studying PRA1F3 localization and dynamics?

Advanced imaging techniques provide crucial insights into PRA1F3 localization, dynamics, and function within the endomembrane system. The following methods are particularly informative:

  • Confocal Laser Scanning Microscopy (CLSM):

    • Generate stable Arabidopsis lines expressing PRA1F3-fluorescent protein fusions (GFP, mCherry, or mCitrine).

    • Perform co-localization studies with established markers for different endomembrane compartments:

      • RabF2b for early endosomes

      • RabG3c for late endosomes

      • VTI12 for the trans-Golgi network

      • Vacuolar markers such as γ-TIP

    • Quantify co-localization using Pearson's correlation coefficient or Manders' overlap coefficient.

  • Super-Resolution Microscopy:

    • Apply Structured Illumination Microscopy (SIM) to resolve PRA1F3 distribution within membrane subdomains.

    • Use Stimulated Emission Depletion (STED) microscopy to visualize interactions between PRA1F3 and Rab proteins at nanoscale resolution.

    • Implement Single-Molecule Localization Microscopy (PALM/STORM) to track individual PRA1F3 molecules and determine their clustering patterns.

  • Live-Cell Imaging for Dynamics:

    • Employ Fluorescence Recovery After Photobleaching (FRAP) to measure PRA1F3 mobility within membranes.

    • Use Fluorescence Correlation Spectroscopy (FCS) to determine diffusion coefficients and molecular interactions.

    • Implement Förster Resonance Energy Transfer (FRET) to detect direct interactions between PRA1F3 and its binding partners in vivo.

  • Multi-Channel Time-Lapse Imaging:

    • Track PRA1F3-labeled vesicles in relation to cargo proteins to visualize transport events.

    • Monitor changes in PRA1F3 distribution during developmental processes or in response to environmental stimuli.

    • Quantify vesicle formation, movement, and fusion rates to assess trafficking dynamics.

These imaging approaches, combined with appropriate image analysis tools and quantification methods, can provide unprecedented insights into how PRA1F3 functions within the complex and dynamic endomembrane system of plant cells . The results can be correlated with biochemical interaction studies to build a comprehensive model of PRA1F3's role in vacuolar protein transport.

What are the key unresolved questions about PRA1F3 function and regulation?

Despite significant advances in understanding PRA1F3's role in vacuolar protein transport, several critical questions remain unresolved that warrant further investigation:

  • Structural Determinants of Specificity: The precise structural features that enable PRA1F3 to interact specifically with certain Rab proteins and SNAREs remain unclear. Crystal structure determination of PRA1F3 in complex with its binding partners would provide valuable insights into these molecular recognition events.

  • Regulatory Mechanisms: The factors controlling PRA1F3 expression, localization, and activity under different developmental stages and stress conditions are poorly understood. Investigation of post-translational modifications and protein turnover rates could reveal dynamic regulation mechanisms.

  • Functional Redundancy: The extent to which other members of the PRA1 family can compensate for PRA1F3 function requires systematic analysis of multiple knockout lines and protein interaction profiles. This would help delineate unique versus overlapping functions within this protein family.

  • Integration with Cellular Signaling: How PRA1F3-mediated vesicle trafficking interfaces with cellular signaling pathways, particularly during stress responses and immune function, represents an important area for future research .

  • Evolutionary Adaptation: Understanding how variations in PRA1F3 sequence and expression across Arabidopsis accessions correlate with environmental adaptation would provide insights into the evolutionary significance of vesicle trafficking dynamics .

Addressing these questions will require integrative approaches combining structural biology, systems biology, and evolutionary analysis. The development of new methodologies for real-time tracking of protein-protein interactions in planta will be particularly valuable for understanding the dynamic aspects of PRA1F3 function in vacuolar protein transport .

What are the essential resources for researchers studying PRA1F3?

Researchers investigating PRA1F3 should consider the following essential resources to support their studies:

  • Genetic Materials:

    • T-DNA insertion lines for PRA1F3 (At3g13720) available from stock centers (ABRC, NASC)

    • CRISPR-Cas9 knockout lines generated by various labs

    • Fluorescent protein fusion lines for localization studies

    • Complementation lines expressing variants of PRA1F3

  • Protein Resources:

    • Recombinant PRA1F3 protein for in vitro studies (as detailed in search result )

    • Antibodies against PRA1F3 for western blotting and immunolocalization

    • Expression vectors containing the PRA1F3 sequence with various tags

  • Databases and Bioinformatic Tools:

    • The Arabidopsis Information Resource (TAIR) for gene annotation and expression data

    • UniProt entry Q9LIC6 for protein sequence and functional annotation

    • 1,135 Arabidopsis genome sequences for natural variation analysis

    • Epigenome maps showing histone modifications at the PRA1F3 locus

  • Experimental Protocols:

    • Co-immunoprecipitation protocols optimized for membrane proteins

    • Split ubiquitin yeast two-hybrid assays for membrane protein interactions

    • Vacuolar trafficking assays using fluorescent cargo proteins

    • Membrane fractionation techniques for subcellular localization

  • Collaborative Networks:

    • The Arabidopsis membrane trafficking research community

    • Structural biology consortia for membrane protein crystallization

    • Plant stress response networks for understanding functional contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.