Recombinant Arabidopsis thaliana PRA1 family protein G2 (PRA1G2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vesicle Trafficking

PRA1G2 is hypothesized to act as a receptor for Rab GTPases and SNARE proteins, similar to other PRA1 family members:

  • Coexpression Networks: PRA1G2 shows significant coexpression (r > 0.9) with Rab GTPases (e.g., RabA1g, RabF2b) and vesicle transport proteins like VAMP721 .

  • Subcellular Localization: Predicted to localize to endosomal/prevacuolar compartments, Golgi apparatus, or ER based on homology to PRA1A2 and PRA1H .

  • Interaction Partners:

    • Heterodimerizes with PRA1A2, PRA1B5, and PRA1G1 (STRING interaction score: 0.926) .

    • May bind to VAMP2 homologs involved in vacuolar trafficking .

Recombinant Production Strategies

While no direct studies on PRA1G2 expression exist, protocols for homologous PRA1 proteins (e.g., PRA1A2) provide a roadmap:

Table: Recombinant Production Parameters for PRA1 Family Proteins

ParameterPRA1A2Hypothetical PRA1G2 Protocol
Expression SystemE. coli (BL21-DE3)E. coli or Pichia pastoris
VectorpET-based with T7 promoterpET or pPICZα (for glycosylation)
TagsN-terminal His-tagHis-tag or GFP fusion
SolubilityInsoluble inclusion bodiesMay require refolding/ligand screening
Yield~1.2 mg/L culture Estimated 0.5–2 mg/L
Purity>90% (SDS-PAGE verified) Target >85%

Validated Uses of PRA1 Family Proteins

  • Vesicle Trafficking Assays: Reconstituted with Rab GTPases to study membrane fusion in vitro .

  • Pathogen Interaction Studies: PRA1 homologs regulate host-pathogen interfaces (e.g., Hyaloperonospora arabidopsidis) .

  • Hormone Signaling: Linked to brassinosteroid-induced miRNA networks modulating trafficking .

Critical Knowledge Gaps for PRA1G2

  1. Structural Data: No crystal/NMR structures available.

  2. Direct Functional Evidence: Knockout mutants or overexpression phenotypes unreported.

  3. Post-Translational Modifications: Glycosylation sites remain unverified.

Future Research Directions

  1. CRISPR-Cas9 Mutants: Generate PRA1G2 knockout lines to assess developmental phenotypes.

  2. Live-Cell Imaging: Fuse PRA1G2 with fluorescent tags (e.g., mKATE2) to track dynamic localization .

  3. Proteomic Screens: Identify interactors using affinity purification-mass spectrometry.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of the product is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRA1G2; At5g56230; K24C1.4; PRA1 family protein G2; AtPRA1.G2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PRA1G2
Target Protein Sequence
MTPSPPPITYISIPLPTNDVVSRSIHNLTTAISSHRPWSELIFSGDFSLPESFSSLLLRS KTNFNYFFVNYTIIVSTCAAFALITASPVALIVVGAIIALWLIFHFFREDPLILWSFQVG DRTVLLFLVLASVWAIWFTNSAVNLAVGVSVGLLLCIIHAVFRNSDELFLEEDDAINGGL IGSNLR
Uniprot No.

Target Background

Function
This protein may be involved in both secretory and endocytic intracellular trafficking within the endosomal/prevacuolar compartments.
Database Links

KEGG: ath:AT5G56230

STRING: 3702.AT5G56230.1

UniGene: At.29399

Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots and trichomes.

Q&A

What is the function of PRA1G2 in Arabidopsis thaliana?

PRA1G2 belongs to the Prenylated Rab Acceptor family of proteins that are involved in vesicular trafficking in plants. These proteins typically function in the endomembrane system, particularly in protein transport between the endoplasmic reticulum and Golgi apparatus. While specific research on PRA1G2 is limited, related studies on Arabidopsis proteins indicate its potential role in maintaining cellular homeostasis during stress responses, similar to how PARG1 functions in DNA repair processes. The protein likely interacts with small GTPases of the Rab family to facilitate vesicle formation and trafficking. Expression patterns suggest involvement in developmental processes, particularly in meristematic tissues, similar to other regulatory proteins in Arabidopsis that show tissue-specific expression patterns.

How is PRA1G2 gene expression regulated in Arabidopsis?

Gene expression regulation of PRA1G2 likely involves both developmental and stress-responsive elements in its promoter region. Similar to other Arabidopsis genes like PARG1, PRA1G2 expression may be induced in specific tissues such as root and shoot meristems under certain conditions . Analysis of promoter regions could reveal binding sites for specific transcription factors, potentially including the HD-ZIP transcription factors ATML1 and PDF2, which are known to regulate epidermal-specific gene expression in Arabidopsis . Expression might also be modulated by hormonal signals such as gibberellic acid (GA), as observed with other Arabidopsis genes. Temporal expression patterns should be quantified using quantitative RT-PCR (qRT-PCR) across different developmental stages and under various stress conditions to fully understand its regulation.

What cellular compartments contain PRA1G2 protein?

Based on structural features common to the PRA1 family, PRA1G2 is likely localized primarily to membranes of the early secretory pathway, particularly the endoplasmic reticulum and Golgi apparatus. Subcellular localization can be experimentally determined using fluorescent protein fusions (such as GFP-PRA1G2) and confocal microscopy imaging of transgenic Arabidopsis plants or transiently transformed protoplasts. Fractionation studies can provide biochemical confirmation of the protein's localization, separating cellular components through differential centrifugation followed by immunoblotting with specific antibodies. Immunogold labeling for electron microscopy would provide the highest resolution evidence for precise subcellular localization, allowing researchers to distinguish between closely related compartments within the endomembrane system.

What is the optimal expression system for producing recombinant PRA1G2?

The optimal expression system for recombinant PRA1G2 should be determined through systematic experimental design approaches that evaluate multiple variables simultaneously. Based on recombinant protein expression studies, a multivariant analysis examining factors such as host strain, induction temperature, inducer concentration, media composition, and induction time would be most effective . For membrane proteins like PRA1G2, specialized E. coli strains such as C41(DE3) or C43(DE3) often provide better results than standard BL21(DE3). Expression conditions should be optimized using a fractional factorial design (similar to the 2^8-4 design described in the literature) to efficiently identify significant variables with minimal experiments . The following experimental conditions represent a starting point based on similar membrane protein expression studies:

VariableLow LevelHigh LevelCenter Point
Temperature16°C30°C23°C
IPTG concentration0.1 mM1.0 mM0.55 mM
Post-induction time4 h16 h10 h
Media typeLB2×YTTB
OD600 at induction0.61.20.9

The responses should be measured in terms of total protein yield, soluble fraction percentage, and functional activity if applicable, with statistical analysis to determine optimal conditions .

How can the solubility of recombinant PRA1G2 be improved during expression?

Improving PRA1G2 solubility requires strategies addressing its membrane protein nature. Fusion tags such as MBP (maltose-binding protein), NusA, or SUMO can significantly enhance solubility and should be tested in parallel expression trials. The addition of membrane-mimetic compounds to the culture medium, such as mild detergents or phospholipids, can create an environment more conducive to proper folding of membrane proteins. Reducing the rate of protein synthesis by lowering temperature (to 16-20°C) and inducer concentration allows more time for proper folding and membrane insertion, potentially increasing the proportion of correctly folded protein . Specialized E. coli strains that co-express molecular chaperones (e.g., GroEL/GroES, DnaK/DnaJ) can further assist proper folding. For optimal outcomes, employ statistical design of experiments (DoE) methodology to simultaneously evaluate multiple variables, as this approach has proven valuable for optimizing soluble expression of challenging proteins, achieving up to 250 mg/L of soluble recombinant protein in some cases .

What purification strategy is most effective for recombinant PRA1G2?

The most effective purification strategy for recombinant PRA1G2 should involve a multi-step approach tailored to membrane protein characteristics. Initial extraction requires careful selection of detergents, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often providing good results for membrane proteins. Affinity chromatography using a fusion tag (His6, GST, or MBP) provides the first purification step, followed by size exclusion chromatography to separate monomeric protein from aggregates and remove remaining contaminants. For highest purity, an ion exchange chromatography step can be included between these steps. The purification buffer should be optimized for protein stability, typically containing 150-300 mM NaCl, a pH buffer (such as Tris or HEPES at pH 7.5-8.0), and detergent at concentrations slightly above the critical micelle concentration. Protein quality at each step should be assessed by SDS-PAGE, Western blotting, and if possible, functional assays to ensure the purification process yields properly folded, active protein.

How can protein-protein interactions of PRA1G2 be effectively studied?

Protein-protein interactions of PRA1G2 can be studied using complementary approaches to overcome challenges associated with membrane proteins. Yeast two-hybrid (Y2H) analysis using modified systems designed for membrane proteins (such as split-ubiquitin Y2H) can identify potential interacting partners, similar to the approach used to study DELLA protein interactions with ATML1 . Co-immunoprecipitation (Co-IP) using epitope-tagged PRA1G2 expressed in Arabidopsis or a heterologous system can confirm interactions in a more native context, while bimolecular fluorescence complementation (BiFC) provides spatial information about where in the cell these interactions occur. For higher confidence, in vitro pull-down assays using recombinant PRA1G2 and putative partners can validate direct interactions. Quantitative interaction analysis using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) would provide binding affinity data for confirmed interactions. Mass spectrometry-based approaches like proximity-dependent biotin identification (BioID) or tandem affinity purification coupled with mass spectrometry (TAP-MS) offer unbiased discovery of the broader PRA1G2 interactome.

What phenotypic analyses are most informative for understanding PRA1G2 function?

Comprehensive phenotypic analysis of PRA1G2 mutants should span multiple scales from subcellular to whole-plant levels. At the subcellular level, transmission electron microscopy can reveal ultrastructural changes in organelle morphology, particularly in the endomembrane system. Vesicle trafficking assays using fluorescent markers or cargo proteins would directly test functional impairment in the secretory pathway. At the cellular level, growth and division patterns should be analyzed in specific tissues, with particular attention to meristematic regions where expression might be highest, similar to PARG1 . Whole-plant phenotypic analysis should include detailed growth measurements (primary root length, lateral root number, rosette diameter, bolting time) under normal and stress conditions. Specialized assays may be needed to detect subtle phenotypes, as functional redundancy among PRA1 family members may mask defects in single mutants. Analyzing double or higher-order mutants with related family members, as was done with PARP and PARG genes, might be necessary to reveal functions obscured by genetic redundancy .

How can CRISPR-Cas9 technology be optimized for studying PRA1G2 function?

Optimizing CRISPR-Cas9 technology for studying PRA1G2 requires careful design strategies to ensure specificity and efficiency. Guide RNA (gRNA) design should prioritize targeting functionally critical regions of the protein while avoiding off-target effects by selecting sequences with minimal homology to other genomic regions, particularly other PRA1 family members. Multiple gRNAs targeting different exons should be tested in parallel to identify those with highest editing efficiency. For precise modifications, homology-directed repair (HDR) templates can be designed to introduce specific mutations or epitope tags at the endogenous locus. Tissue-specific or inducible CRISPR systems using appropriate promoters can overcome potential lethality issues if PRA1G2 has essential functions. Screening for edited plants should employ a multi-tier approach, starting with PCR-based genotyping followed by Sanger sequencing of candidates, and ultimately deep sequencing to comprehensively characterize the edited sites. Phenotypic validation should include complementation tests to confirm that observed phenotypes are directly due to PRA1G2 modification rather than off-target effects.

What statistical approaches are most appropriate for analyzing PRA1G2 expression data?

The statistical analysis of PRA1G2 expression data requires methods that can handle the complexity of gene expression patterns across different conditions. For qRT-PCR data, normalization should use multiple reference genes validated for stability across the experimental conditions, with statistical testing via ANOVA followed by appropriate post-hoc tests for multiple comparisons. For transcriptome-wide studies, differential expression analysis packages like DESeq2 or edgeR provide robust statistical frameworks that handle the non-normal distribution characteristics of RNA-Seq count data. Time-course expression data should be analyzed using specialized methods such as maSigPro or next-maSigPro that can identify significant temporal patterns. Co-expression network analysis can place PRA1G2 in the context of broader gene regulatory networks, identifying modules of genes with similar expression patterns that might share biological functions. All analyses should include appropriate corrections for multiple testing (such as Benjamini-Hochberg procedure) to control false discovery rates, and results should be validated using independent datasets or alternative techniques when possible.

How should contradictory findings about PRA1G2 function be reconciled and addressed?

Contradictory findings about PRA1G2 function should be addressed through a systematic approach that examines multiple potential sources of discrepancies. Begin by comparing the experimental systems used in different studies, as results from heterologous expression systems may differ from observations in planta. Genetic background differences should be carefully considered, as the ecotype or presence of modifiers can influence phenotypic outcomes. Methodological variations in protein extraction, assay conditions, or data analysis parameters can lead to apparently conflicting results despite underlying biological consistency. Re-examining primary data from contradictory studies may reveal that the findings are actually compatible when considering different aspects of the protein's multifunctional nature, similar to how PARP and PARG proteins show complex and sometimes seemingly contradictory phenotypes in different assays . Design new experiments specifically to test competing hypotheses, ideally combining approaches from the contradictory studies in a single experimental framework. Collaboration between groups reporting different findings can be particularly valuable for resolving discrepancies through shared materials and standardized protocols.

What bioinformatic tools are most valuable for predicting PRA1G2 structure and function?

Bioinformatic analysis of PRA1G2 should employ multiple complementary tools to build a comprehensive prediction of its structure and function. Sequence-based analysis should begin with multiple sequence alignments of PRA1 family proteins across species to identify conserved regions likely crucial for function. Transmembrane topology prediction tools (TMHMM, Phobius, TOPCONS) are particularly important for membrane proteins like PRA1G2 to identify membrane-spanning regions and orientation. Structural prediction has advanced significantly with AlphaFold2 and RoseTTAFold, which can generate reliable protein structure models even for membrane proteins with limited experimental structural data. These models can be refined using molecular dynamics simulations in membrane environments. Functional prediction should incorporate protein domain analysis (InterPro, Pfam), subcellular localization prediction (TargetP, LOCALIZER), and protein-protein interaction prediction (STRING database). Integrating these diverse predictions with experimental data from related proteins can generate testable hypotheses about PRA1G2 function, guiding experimental design for validation studies.

How can issues with antibody specificity against PRA1G2 be resolved?

Resolving antibody specificity issues for PRA1G2 requires a comprehensive approach combining multiple validation methods. When developing new antibodies, carefully select unique epitopes with minimal similarity to other PRA1 family members, ideally using immunoinformatic tools to identify peptide regions with high antigenicity and specificity. Validation should employ multiple controls including testing antibodies against recombinant PRA1G2 protein, protein extracts from overexpression lines, and most importantly, pra1g2 knockout mutants to confirm absence of signal. Pre-absorption tests, where the antibody is pre-incubated with excess antigen before immunodetection, can confirm specific binding. Cross-reactivity with other PRA1 family members should be systematically assessed using recombinant proteins or overexpression lines of each family member. Alternative approaches to circumvent antibody issues include epitope tagging of PRA1G2 in its native genomic context using CRISPR-Cas9, allowing detection with highly specific commercial tag antibodies. For quantitative applications, multiple antibodies targeting different epitopes should be compared to ensure consistent results.

What are the best approaches for troubleshooting failed PRA1G2 expression experiments?

Troubleshooting failed PRA1G2 expression experiments requires systematic assessment of each step in the expression and detection process. Begin by verifying the construct sequence to ensure no mutations were introduced during cloning that might affect expression or protein function. For low expression levels, examine transcription using RT-PCR to determine if the issue occurs at the transcriptional or translational level. If mRNA is present but protein is not detected, consider codon optimization for the expression system, as rare codons can significantly impact translation efficiency. For membrane proteins like PRA1G2, extraction methods are critical—test multiple detergents and lysis conditions to ensure the protein is effectively solubilized from membranes. If the protein is being degraded, add protease inhibitors throughout the purification process and consider reducing the temperature during expression and handling. Expression as a fusion protein with solubility-enhancing partners (MBP, SUMO, etc.) can improve both expression and detection. Implement a fractional factorial design approach to systematically test multiple variables simultaneously, similar to the methodology used for recombinant protein expression optimization that achieved high yields (250 mg/L) for challenging proteins .

What emerging technologies will advance understanding of PRA1G2 dynamics in vivo?

Emerging technologies poised to revolutionize our understanding of PRA1G2 dynamics include advanced imaging techniques that enable visualization of protein behavior in living cells with unprecedented resolution. Super-resolution microscopy methods such as PALM, STORM, or lattice light-sheet microscopy can overcome the diffraction limit to visualize PRA1G2 localization and trafficking at nanometer scales. Optogenetic tools adapted for plant systems will allow precise temporal control of PRA1G2 activity or localization through light-responsive domains. CRISPR-based technologies beyond gene editing, such as CRISPRi for transcriptional repression or CRISPRa for activation, can provide tunable manipulation of PRA1G2 expression levels. Single-cell technologies including single-cell RNA-seq and spatial transcriptomics will reveal cell-type specific expression patterns and responses to environmental cues with unprecedented resolution. Proximity labeling methods like TurboID adapted for plants can map the protein interaction neighborhood of PRA1G2 in specific cellular compartments. Integration of these technologies with computational modeling approaches will enable systems-level understanding of how PRA1G2 functions within membrane trafficking networks in response to developmental and environmental signals.

How can quantitative proteomics enhance our understanding of PRA1G2 regulation?

Quantitative proteomics approaches offer powerful tools for understanding PRA1G2 regulation at multiple levels. Stable isotope labeling (SILAC or TMT labeling) coupled with mass spectrometry can quantify changes in PRA1G2 abundance across developmental stages, tissues, or in response to environmental stresses. Post-translational modification (PTM) analysis using enrichment strategies coupled with mass spectrometry can identify regulatory modifications of PRA1G2, such as phosphorylation, ubiquitination, or prenylation, which may control its function or localization. Protein turnover studies using pulse-chase approaches with heavy isotope labeling can determine the half-life of PRA1G2 and how it changes under different conditions. Absolute quantification using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can determine the precise copy number of PRA1G2 molecules per cell, providing insights into its stoichiometry relative to interacting partners. Proximity-dependent labeling methods adapted for quantitative proteomics can capture dynamic changes in the PRA1G2 interaction network under different conditions or treatments. Integration of proteomics data with transcriptomics and metabolomics in a multi-omics approach will provide a comprehensive understanding of how PRA1G2 functions within broader cellular networks.

What are the implications of PRA1G2 research for understanding conserved membrane trafficking mechanisms?

Research on Arabidopsis PRA1G2 has significant implications for understanding evolutionarily conserved membrane trafficking mechanisms across eukaryotes. Comparative studies of PRA1 family proteins across species can reveal functionally conserved domains and mechanisms that have been maintained throughout evolution, providing insights into fundamental aspects of membrane trafficking. The plant endomembrane system has unique features compared to animal and fungal systems, including the presence of chloroplasts and a complex vacuolar system, making PRA1G2 research valuable for identifying both conserved and plant-specific trafficking mechanisms. Understanding PRA1G2 function may reveal novel regulatory points in vesicle trafficking that could be targeted to enhance desired plant traits such as stress resistance or nutrient use efficiency. The experimental approaches developed for studying PRA1G2, such as optimized recombinant expression systems for membrane proteins, may be applicable to other challenging membrane proteins across species . Systems-level integration of PRA1G2 function with other trafficking components will contribute to building predictive models of endomembrane dynamics that could have applications across biology and biotechnology. As membrane trafficking is essential for numerous cellular processes, insights from PRA1G2 research may have broad implications for understanding fundamental cellular functions and their dysregulation in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.