Recombinant Arabidopsis thaliana Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 (LPAT5)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

LPAT5 exhibits regiospecific sn-2 acylation of glycerol-3-phosphate (G3P), producing 2-acyl lysophosphatidic acid (2-acyl-LPA) in vitro . Key enzymatic properties include:

ParameterDetails
Primary SubstratesVery long-chain fatty acids (VLCFAs), ω-hydroxy fatty acids (ω-OHFA), dicarboxylic acids (DCA)
Regiospecificitysn-2 position preference
Product2-acyl-LPA (in vitro); extracellular sn-2 monoacylglycerol (MAG) in vivo via phospholipase activity
CofactorsRequires acyl-CoA derivatives as acyl donors

LPAT5 demonstrates broad acyl-CoA specificity, enabling the incorporation of diverse fatty acid derivatives into suberin precursors . Unlike GPAT4/6, it lacks phosphatase activity, making it a dedicated acyltransferase .

Biological Role in Suberin Biosynthesis

LPAT5 is indispensable for suberin aliphatic polymer assembly in roots and seed coats. Mutants lacking functional LPAT5 exhibit:

  • Reduced VLCFA, ω-OHFA, and DCA accumulation in suberin monomers .

  • Compromised barrier function, increasing susceptibility to pathogens and environmental stress .

Suberin, a glycerolipid polymer, provides structural integrity and protection in plant tissues. LPAT5’s sn-2 acylation ensures the formation of thermodynamically less stable but biologically critical intermediates like 2-acyl-LPA, which are subsequently processed into extracellular MAGs by endogenous phospholipases .

Recombinant LPAT5 Production and Applications

The recombinant LPAT5 protein (Cat. No. RFL1192AF) is optimized for enzymatic assays and structural studies:

PropertyDetails
Expression SystemE. coli (T5 promoter system)
SolubilityLyophilized powder; reconstituted in deionized water (0.1–1.0 mg/mL)
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionAdd 5–50% glycerol for long-term storage

This recombinant protein is used to:

  • Study acyltransferase kinetics with diverse acyl-CoA substrates.

  • Map substrate specificity for VLCFAs and ω-OHFA.

  • Investigate interactions with phospholipases in suberin biosynthesis .

Evolutionary Significance

LPAT5 homologs are absent in algae, fungi, and animals, suggesting their evolution coincided with terrestrial plant adaptation . These acyltransferases enabled the synthesis of extracellular glycerolipid barriers, a hallmark of land plant survival .

Redundancy and Stress Response

LPAT5 shares partial redundancy with LPAT4, particularly in nitrogen (N)-starvation responses. Double mutants (lpat4-1 lpat5-1) show severe growth defects under N deficiency, highlighting its role in triacylglycerol (TAG) and phospholipid biosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LPAT5; LPAAT5; At3g18850; MCB22.2; Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5; Lysophosphatidyl acyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LPAT5
Target Protein Sequence
MEKKSVPNSDKLSLIRVLRGIICLMVLVSTAFMMLIFWGFLSAVVLRLFSIRYSRKCVSF FFGSWLALWPFLFEKINKTKVIFSGDKVPCEDRVLLIANHRTEVDWMYFWDLALRKGQIG NIKYVLKSSLMKLPLFGWAFHLFEFIPVERRWEVDEANLRQIVSSFKDPRDALWLALFPE GTDYTEAKCQRSKKFAAENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYKTRC PSFLDNVYGIEPSEVHIHIRRINLTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHFPN EGTEKEFNTKKYLINCLAVIAFTTICTHLTFFSSMIWFRIYVSLACVYLTSATHFNLRSV PLVETAKNSLKLVNK
Uniprot No.

Target Background

Function

This protein may catalyze the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acyl moiety incorporation at the sn-2 position. It exhibits no activity when expressed in bacteria or yeast.

Database Links

KEGG: ath:AT3G18850

STRING: 3702.AT3G18850.1

UniGene: At.8309

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed at low level.

Q&A

Basic Research Questions

  • What is the enzymatic function of LPAT5 in Arabidopsis thaliana?

LPAT5 catalyzes an important step in the de novo phospholipid biosynthesis pathway, specifically the acylation of lysophosphatidic acid (LPA) to form phosphatidic acid (PA). This enzyme belongs to a family of five LPAT isoforms in Arabidopsis and has a strong flux control in the biosynthesis of both phospholipids and triacylglycerol (TAG) .

Methodologically, the enzymatic activity of LPAT5 can be assessed through in vitro assays using various acyl-CoA substrates and lysophosphatidic acid. The reaction typically involves:

  • Incubation of purified recombinant LPAT5 with lysophosphatidic acid and acyl-CoA donors

  • Monitoring the formation of phosphatidic acid using thin-layer chromatography or LC-MS

  • Quantifying activity by measuring the incorporation of radiolabeled acyl-CoA substrates

  • How is LPAT5 structurally and functionally related to other acyltransferases in Arabidopsis?

While LPAT5 is specifically involved in lysophosphatidic acid acylation at the sn-2 position, Arabidopsis also contains other acyltransferase families like the glycerol-3-phosphate acyltransferases (GPATs) that act on different substrates . The key differences include:

AcyltransferasePrimary SubstrateProductSubcellular LocalizationRegiospecificity
LPAT5Lysophosphatidic acidPhosphatidic acidEndoplasmic reticulumsn-2
GPATs (1-3)Glycerol-3-phosphateLPAVarioussn-2
GPATs (4,6,8)Glycerol-3-phosphate2-monoacylglycerolERsn-2 with phosphatase activity
GPAT5,7Glycerol-3-phosphateLPAERsn-2 without phosphatase

Unlike membrane-bound GPATs such as GPAT4-8 which can have bifunctional acyltransferase/phosphatase activity resulting in 2-monoacylglycerol products, LPAT5 specifically produces phosphatidic acid for membrane and storage lipid synthesis .

  • What phenotypes are observed in LPAT5 knockout mutants?

The functional characterization of LPAT5 reveals several phenotypic changes in knockout mutants:

  • Single LPAT5 mutants show minimal phenotypic changes under normal growth conditions, suggesting functional redundancy with other LPATs

  • Double knockout mutants (lpat4-1 lpat5-1) display reduced content of phospholipids and triacylglycerol (TAG) under normal growth conditions

  • Under nitrogen starvation, lpat4-1 lpat5-1 seedlings exhibit more severe growth defects than wild-type plants, particularly in shoot development

  • The phenotype of lpat4-1 lpat5-1 is similar to dgat1-4 mutants, which affect a major TAG biosynthesis pathway

These observations suggest that LPAT4 and LPAT5 redundantly function in endoplasmic-reticulum-localized de novo glycerolipid biosynthesis for phospholipids and TAG, which is important for the nitrogen starvation response in Arabidopsis .

Advanced Research Questions

  • How does LPAT5 contribute to nitrogen starvation responses in Arabidopsis?

LPAT5 plays a critical role in the adaptation of Arabidopsis to nitrogen starvation through its involvement in lipid metabolism:

Methodologically, to study LPAT5's role in nitrogen starvation:

  • Grow wild-type and mutant plants on nitrogen-replete media, then transfer to nitrogen-deficient media

  • Analyze lipid profiles using thin-layer chromatography and gas chromatography-mass spectrometry

  • Quantify TAG and membrane lipid levels at different time points after transfer

  • Measure growth parameters and photosynthetic efficiency to assess physiological impacts

  • What methods can be used to express and purify recombinant LPAT5 for functional studies?

Recombinant expression and purification of LPAT5 requires specific approaches to maintain the functionality of this membrane-associated enzyme:

  • Expression system selection:

    • Yeast expression systems (such as Saccharomyces cerevisiae or Pichia pastoris) are commonly used for plant membrane proteins

    • Bacterial systems may be used for partial proteins (soluble domains)

  • Construct design:

    • Include appropriate affinity tags (His-tag is commonly used) for purification

    • Consider using codon-optimized sequences for the expression host

    • For full-length protein, include the transmembrane domains for proper folding

  • Purification strategy:

    • Cell disruption using gentle methods to preserve membrane integrity

    • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

    • Affinity chromatography followed by size exclusion chromatography

    • Maintain glycerol (5-50%) in storage buffers to preserve activity

  • Activity verification:

    • In vitro enzymatic assays using lysophosphatidic acid and various acyl-CoA substrates

    • Analysis of products using thin-layer chromatography or LC-MS

Recombinant LPAT5 proteins are commercially available with reported purity of >85% by SDS-PAGE, typically expressed in yeast systems .

  • How can complementation studies be designed to confirm LPAT5 function in vivo?

Complementation studies are essential to confirm that phenotypes observed in mutants are specifically due to LPAT5 deficiency:

  • Construct preparation:

    • Clone the full-length LPAT5 coding sequence into a plant expression vector

    • Use either the native promoter for physiological expression or a constitutive promoter like CaMV 35S

    • Include appropriate plant selection markers (e.g., kanamycin resistance)

  • Transformation methods:

    • Transform lpat5 single mutants or lpat4 lpat5 double mutants using Agrobacterium-mediated floral dip transformation

    • Select transformants on appropriate antibiotics

    • Confirm transgene integration by PCR and expression by RT-PCR

  • Phenotypic analysis:

    • Evaluate restoration of wild-type phenotypes, particularly under nitrogen limitation

    • Analyze lipid profiles (phospholipids and TAG) using chromatographic methods

    • Assess growth parameters, especially under stress conditions

  • Controls:

    • Include wild-type plants, non-transformed mutants, and mutants transformed with empty vector

    • For specificity, consider complementation with other LPAT family members

This approach was successfully used for complementation studies of other acyltransferases in Arabidopsis, as demonstrated with GPAT1 and LPA19 .

  • What are the substrate specificities of LPAT5 compared to other acyltransferases in Arabidopsis?

Understanding substrate specificities is crucial for elucidating the precise biochemical roles of different acyltransferases:

While specific substrate preferences for LPAT5 are not directly presented in the search results, information about other acyltransferases provides comparative insights:

AcyltransferaseChain Length PreferenceOxidation State PreferenceUnsaturation Preference
GPAT5Broad specificity (C16-C24) with preference for C22No strong discrimination between oxidized and non-oxidized longer chain lengthsDiscrimination against unsaturated substrates
GPAT4/6/8Strong preference for C16:0 and C18:1Strong preference for ω-oxidized acyl-CoAsAccommodates unsaturated substrates
GPAT1Highest with C20:0-CoA (10-fold above C16:0 or C18:1)Can accept ω-oxidized acyl-CoAs (e.g., C22:0 DCA-CoA)Moderate activity with C18:1

For LPAT5, experimental approaches to determine substrate specificity would include:

  • In vitro enzymatic assays with purified recombinant LPAT5

  • Testing various acyl-CoA donors with different chain lengths, degrees of unsaturation, and oxidation states

  • Quantifying reaction rates using radiolabeled substrates or mass spectrometry

  • Determining kinetic parameters (Km, Vmax) for different substrates

  • How does temperature stress affect LPAT5 function and lipid metabolism in Arabidopsis?

While LPAT5-specific temperature responses aren't directly addressed in the search results, studies on other acyltransferases provide important context:

  • Acyltransferases including DGATs and PDATs are involved in triacylglycerol (TAG) accumulation during temperature stress

  • Temperature stress (both high and low) triggers accumulation of polyunsaturated TAG in leaf tissue

  • Loss-of-function mutants in acyltransferase families show reduced effectiveness in TAG production during temperature stress

For studying LPAT5's role in temperature stress:

  • Subject wild-type and lpat5 mutant plants to controlled temperature regimens:

    • Cold acclimation (4°C) followed by freezing temperatures

    • Heat stress protocols (e.g., 37°C for various durations)

  • Analyze changes in:

    • TAG content and composition using lipidomics approaches

    • Membrane lipid saturation/desaturation

    • Double bond index (DBI) in both storage and membrane lipids

    • LPAT5 gene expression using qRT-PCR

  • Assess physiological parameters:

    • Recovery after stress

    • Chlorophyll fluorescence to measure photosystem integrity

    • Growth parameters

  • What genetic mapping approaches can identify quantitative trait loci associated with LPAT5 function?

Advanced genetic mapping approaches can help identify natural variation in LPAT5 function and its impact on lipid metabolism:

  • Population selection:

    • Use recombinant inbred lines (RILs) or advanced intercross lines (AI-RILs) for higher mapping resolution

    • AI-RILs provide expanded genetic maps due to additional recombination events

  • Phenotyping strategies:

    • Analyze lipid profiles across the population under normal and stress conditions

    • Measure TAG accumulation and phospholipid composition

    • Assess growth parameters under nitrogen limitation

  • Genotyping approaches:

    • Use dense marker sets with average intermarker distances of approximately 600 kb

    • Include markers in the LPAT5 region and other lipid metabolism genes

    • Consider whole-genome sequencing for precise variant identification

  • QTL analysis:

    • Identify genomic regions associated with variation in lipid profiles

    • Look for epistatic interactions between LPAT5 and other loci

    • Validate identified QTLs using near-isogenic lines or CRISPR-Cas9 gene editing

This approach has been successfully used in Arabidopsis to identify QTLs for various traits including metabolic responses .

  • How can protein-protein interactions of LPAT5 be studied in the context of lipid biosynthesis pathways?

Understanding LPAT5's interactions with other proteins can provide insights into its regulation and metabolic coordination:

  • In vivo approaches:

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in plant cells

    • Co-immunoprecipitation using antibodies against LPAT5 or epitope-tagged versions

    • Proximity labeling methods (BioID or TurboID) to identify proteins in close proximity to LPAT5 in the ER

  • In vitro approaches:

    • Pull-down assays using recombinant LPAT5 as bait

    • Surface Plasmon Resonance to determine binding kinetics

    • Yeast two-hybrid screening with LPAT5 transmembrane domains removed

  • Functional validation:

    • Analysis of lipid profiles in mutants of identified interactors

    • Enzymatic assays to determine if interactions affect LPAT5 activity

    • Co-expression analysis using publicly available transcriptome data

  • Experimental considerations:

    • Use proper controls for membrane protein interactions

    • Consider detergent selection carefully to maintain native conformations

    • Validate interactions using multiple independent approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.