Recombinant Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 14 (KCS14)

Shipped with Ice Packs
In Stock

Description

Functional Role in VLCFA Biosynthesis

KCS14 is part of the fatty acid elongase complex, which extends malonyl-CoA-derived acyl-CoA chains into VLCFAs (C18–C34). While its exact substrate specificity remains unclear, related KCS enzymes (e.g., KCS1, KCS3) are known to contribute to:

  • Cuticular wax biosynthesis: Chain elongation for aliphatic waxes in epidermal tissues.

  • Suberin formation: Production of aliphatic suberins in seed coats and roots .

Interactions and Functional Partners
KCS14 interacts with other elongation enzymes, including:

ProteinFunctionInteraction Score
KCR1β-Ketoacyl-CoA reductase (VLCFA elongation) 0.741
KCR2Putative reductase (no confirmed activity) 0.719
ELP1-2Elongator complex protein (auxin signaling, transcriptional elongation) 0.663

These interactions suggest KCS14 may coordinate with reductases and regulatory complexes to modulate VLCFA chain length and downstream lipid metabolism .

Recombinant Production and Applications

Recombinant KCS14 is commercially available for research, enabling studies of:

  • Enzymatic activity: In vitro assays to determine substrate specificity and elongation efficiency.

  • Structural biology: Crystallization or cryo-EM studies to resolve active-site architecture.

  • Mutagenesis: Functional analysis of conserved residues (e.g., catalytic motifs) .

Production Parameters

ParameterDetail
Expression SystemE. coli BL21(DE3) or similar strains
Yield~0.4 mg/g fresh weight (Arabidopsis-based systems) , though E. coli yields vary.
Purity>90% (SDS-PAGE)

Tissue-Specific Expression

KCS14 is predominantly expressed in reproductive organs (e.g., flowers, seeds), as inferred from phylogenetic clustering with KCS13 (group VIII) . This contrasts with KCS3 and KCS12, which are active in vegetative tissues .

Functional Redundancy

While KCS14’s role is less characterized than other KCS enzymes (e.g., KCS1, KCS3), its classification as a “probable” synthase suggests potential redundancy with:

  • KCS3/KCS12: Involved in sepal fusion and cuticle integrity during organ development .

  • KCS19: Critical for seed coat suberin synthesis .

Phylogenetic and Functional Relationships

KCS14 belongs to the Arabidopsis KCS family (21 members), which includes:

  • FAE1-type (e.g., KCS1, KCS20): Specialized for wax elongation.

  • ELO-type (e.g., KCS14, KCS26): Potential roles in suberin or sphingolipid biosynthesis .

Knowledge Gaps and Future Directions

  1. Substrate Specificity: No direct evidence exists for KCS14’s chain-length preference (e.g., C18 vs. C24).

  2. In Vivo Function: Mutant phenotypes (e.g., kcs14) are not yet reported, limiting functional validation.

  3. Regulatory Mechanisms: Post-translational modifications (e.g., phosphorylation) remain unstudied.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCS14; At3g10280; F14P13.12; Probable 3-ketoacyl-CoA synthase 14; KCS-14; Very long-chain fatty acid condensing enzyme 14; VLCFA condensing enzyme 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-459
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS14
Target Protein Sequence
LHFHHDFFSPFPVKIGLLLISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSETFFNMA KGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSL FKKTGIEPREVGIFIVNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSGISVDLATNLLKA NPNTYAVIVSTENMTLSMYRGNDRSMLVPNCLFRVGGAAVMLSNRSQDRVRSKYELTHIV RTHKGSSDKHYTCAEQKEDSKGIVGVALSKELTVVAGDTLKTNLTALGPLVLPLSEKLRF ILFLVKSKLFRLKVSPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLH RFGNTSSSSLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGN PWGDSVHKYPVHVT
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G10280

STRING: 3702.AT3G10280.1

UniGene: At.36468

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in siliques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.