Recombinant Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 2 (KCS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCS17; KCS2; At4g34510; T4L20.90; 3-ketoacyl-CoA synthase 17; KCS-17; Very long-chain fatty acid condensing enzyme 17; VLCFA condensing enzyme 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS17
Target Protein Sequence
MDANGGPVQIRTQNYVKLGYHYLITHFFKLMFLPLMAVLFMNVSLLSLNHLQLYYNSTGF IFVITLAIVGSIVFFMSRPRSIYLLDYSCYLPPSSQKVSYQKFMNNSSLIQDFSETSLEF QRKILIRSGLGEETYLPDSIHSIPPRPTMAAAREEAEQVIFGALDNLFENTKINPREIGV LVVNCSLFNPTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLASDMLQIHRNTFA LVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGS DENAFNCVYQEQDECLKTGVSLSKDLMAIAGEALKTNITSLGPLVLPISEQILFFATFVA KRLFNDKKKKPYIPDFKLALDHFCIHAGGRAVIDELEKSLKLSPKHVEASRMTLHRFGNT SSSSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVEPSVNNPWEHCIHR YPVKIDL
Uniprot No.

Target Background

Function
Active on saturated acyl-CoAs up to C22. It catalyzes the synthesis of very-long-chain fatty acids (VLCFAs) ranging from 20 to 26 carbons in length (e.g., C20:1, C20, C24, C26).
Database Links

KEGG: ath:AT4G34510

STRING: 3702.AT4G34510.1

UniGene: At.27519

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in flowers.

Q&A

What is the functional role of KCS2 in Arabidopsis thaliana?

KCS2 (also known as DAISY) is a 3-ketoacyl CoA synthase enzyme that plays a critical role in very-long-chain fatty acid (VLCFA) biosynthesis in Arabidopsis thaliana. It catalyzes the first committed step in the fatty acid elongation process, specifically the condensation of C2 units to an acyl CoA. KCS2, along with its functionally redundant partner KCS20, is particularly important for the two-carbon elongation to C22 VLCFA, which serves as essential precursors for both cuticular wax and root suberin biosynthesis .

The enzyme's activity directly influences plant surface properties and stress responses. Research has demonstrated that KCS2 contributes to the production of VLCFAs that are incorporated into cuticular waxes on aerial tissues and suberized layers in roots, which function as barriers against water loss and environmental stresses .

How does KCS2 relate to other members of the KCS family in Arabidopsis?

The Arabidopsis genome contains 21 KCS genes that exhibit varying levels of functional redundancy and tissue-specific expression patterns. Among these, KCS2 shares particularly high functional redundancy with KCS20 . While single mutants of either gene show minimal phenotypic alterations, the double mutant kcs20 kcs2/daisy-1 exhibits significant reductions in epicuticular wax crystals on stems and siliques, resulting in a characteristic glossy green appearance .

In the broader KCS family context, different members show distinct substrate preferences and chain-length specificities. Detailed studies using yeast expression systems have revealed that KCS2, along with KCS18 and KCS20, produces a distinct VLCFA profile compared to other family members such as KCS1, KCS4, KCS5, KCS6, KCS9, and KCS17, which have different substrate specificities .

What techniques are commonly used to express recombinant KCS2 for functional studies?

For recombinant expression of KCS2, researchers typically employ several complementary approaches:

  • Yeast Expression Systems: The KCS2 gene can be cloned and expressed under the control of constitutive promoters (such as ADH1) in yeast strains engineered for fatty acid elongation studies. Two particularly useful strains are the "TRIPLE" strain (containing mutations in multiple elongase genes) and the "TRIPLE Δelo3" strain, which allow for the selective analysis of specific chain-length products .

  • Plant Transient Expression: For in planta verification of function and localization, transient expression in Nicotiana benthamiana leaves provides valuable insights. This approach involves Agrobacterium-mediated transformation and allows for the study of protein activity in a plant cellular context .

  • Arabidopsis Transgenic Complementation: For definitive functional validation, expressing the KCS2 gene in kcs2 mutant backgrounds demonstrates the capacity to rescue phenotypes. This approach has confirmed that expression of KCS2 can restore normal cuticular wax production in stems of the kcs20 kcs2/daisy-1 double mutant .

The choice of expression system depends on the specific research question, with each system offering distinct advantages for studying different aspects of KCS2 function.

How can researchers effectively characterize the substrate specificity of recombinant KCS2?

Characterizing KCS2 substrate specificity requires multiple analytical approaches:

Analytical Protocol for KCS2 Substrate Specificity:

  • Heterologous Expression in Engineered Yeast Strains:

    • Express KCS2 in both TRIPLE and TRIPLE Δelo3 yeast strains

    • The TRIPLE strain is optimal for examining elongation of C18 to C24 acyl chains

    • The TRIPLE Δelo3 strain better reveals activity for C24 to C26 elongation

  • Lipid Extraction and Analysis:

    • Extract fatty acids using standard chloroform-methanol protocols

    • Perform methylation to produce fatty acid methyl esters (FAMEs)

    • Analyze via both GC-MS (for identification) and GC-FID (for quantification)

  • Multivariate Data Analysis:

    • Apply principal component analysis (PCA) to visualize changes in VLCFA profiles

    • Construct biplots to identify specific chain-length products associated with KCS2 activity

    • Compare with other KCS enzymes to establish relative substrate preferences

When characterizing KCS2, researchers should note that in TRIPLE strain experiments, KCS2 (along with KCS18 and KCS20) shows significant separation from control strains in PCA analysis, with PC1 and PC2 representing 68% of the total variance. The corresponding biplots indicated that C20, C22, and C24 products were upregulated in strains expressing these KCS enzymes .

What phenotypic changes would be expected in KCS2 knockout or overexpression lines?

Knockout Effects:

  • Cuticular Wax Reduction:

    • 20% decrease in total stem wax content

    • 15% decrease in total leaf wax content

    • Visibly glossy green appearance of stems and siliques

    • Significant reduction in epicuticular wax crystals

  • Root Abnormalities:

    • Growth retardation

    • Abnormal lamellation of the suberin layer in the endodermis

    • Significant reduction of C22 and C24 VLCFA derivatives

    • Accumulation of C20 VLCFA derivatives in aliphatic suberin

Overexpression Effects:

Transgenic lines overexpressing KCS2 show:

  • 10-34% increase in leaf wax content

  • Enhanced cuticular barrier properties

  • Potential alterations in stress response capabilities

These phenotypic changes highlight the critical role of KCS2 in maintaining plant cuticular and suberin integrity, with implications for drought resistance and other stress responses.

How does osmotic stress modulate KCS2 expression and function?

While KCS2 and KCS20 are functionally redundant in biosynthetic pathways, their expression is differentially regulated under osmotic stress conditions . The specific regulatory mechanisms involve:

  • Transcriptional Regulation:

    • KCS2 and KCS20 show distinct expression patterns across different tissues

    • Osmotic stress conditions trigger differential transcriptional responses between these two genes

    • This suggests specialized roles in stress adaptation despite their biochemical redundancy

  • Functional Implications:

    • The differential regulation may allow fine-tuning of VLCFA composition under stress

    • This potentially contributes to adaptive modifications of cuticular and suberin barriers

    • These modifications likely influence water retention capabilities during drought or osmotic challenge

Researchers investigating KCS2 responses to osmotic stress should consider experimental approaches that:

  • Monitor gene expression changes across multiple time points after stress application

  • Quantify protein levels in addition to transcript abundance

  • Analyze alterations in VLCFA profiles specifically attributed to KCS2 activity

What methodological challenges exist when purifying functional recombinant KCS2 protein?

Purification of functional KCS2 presents several technical challenges that researchers should address:

  • Membrane Protein Considerations:

    • KCS2 is an integral membrane protein associated with the endoplasmic reticulum

    • Standard purification protocols must be modified to maintain proper protein folding and activity

    • Detergent selection is critical, with mild non-ionic detergents typically yielding better results

  • Expression System Selection:

    • Bacterial expression systems often result in inclusion bodies requiring refolding

    • Yeast systems provide a eukaryotic environment but may produce different post-translational modifications

    • Insect cell or plant cell-based expression systems may offer advantages for maintaining native function

  • Activity Retention Verification:

    • In vitro activity assays must be established to confirm functionality of purified protein

    • Reconstitution into artificial lipid bilayers or liposomes may be necessary to restore enzyme activity

    • Co-purification with other fatty acid elongation complex components might be required for full functionality

Researchers have found that expression in yeast systems followed by careful membrane fraction isolation provides a practical compromise between yield and activity for KCS enzymes .

What is the optimal experimental design to study functional redundancy between KCS2 and KCS20?

To effectively investigate the functional redundancy between KCS2 and KCS20, a comprehensive experimental design should include:

Genetic Approach:

  • Generate and analyze single mutants (kcs2, kcs20)

  • Create and characterize double mutants (kcs2 kcs20)

  • Develop complementation lines expressing either gene in the double mutant background

  • Create overexpression lines for each gene in wild-type background

Biochemical Analysis:

  • Quantify cuticular wax content in stems and leaves across all genotypes

  • Determine chain-length distribution of VLCFAs in different tissues

  • Analyze suberin composition, particularly in roots

  • Measure water loss rates and cuticular permeability

Expression Analysis:

  • Compare tissue-specific expression patterns of both genes

  • Monitor expression changes under various stress conditions

  • Perform qRT-PCR across developmental stages

How can researchers accurately quantify the substrate specificity of KCS2 using recombinant protein?

Accurate quantification of KCS2 substrate specificity requires:

In Vitro Enzymatic Assay Protocol:

  • Microsomal Preparation:

    • Isolate microsomes from recombinant expression systems

    • Normalize protein content across samples

    • Verify KCS2 expression by Western blot

  • Substrate Panel Preparation:

    • Prepare a series of acyl-CoA substrates with varying chain lengths (C16-C24)

    • Include both saturated and unsaturated substrates

    • Utilize radiolabeled malonyl-CoA as the C2 donor

  • Reaction Conditions:

    • Optimize temperature, pH, and ionic strength

    • Include appropriate controls (heat-inactivated enzyme, no substrate)

    • Conduct time-course studies to ensure linearity

  • Product Analysis:

    • Extract and methylate fatty acids

    • Separate products by gas chromatography

    • Quantify using appropriate standards

    • Calculate enzyme kinetic parameters (Km, Vmax) for each substrate

Data Table: Relative Activity of KCS2 with Different Substrates

SubstrateRelative Activity (%)Km (μM)Product Chain Length
C16:0-CoA45-6015-25C18:0
C18:0-CoA80-1005-15C20:0
C20:0-CoA90-1003-10C22:0
C22:0-CoA60-808-18C24:0
C24:0-CoA20-4020-30C26:0

Note: This table represents typical values based on similar KCS enzymes; specific values for KCS2 would need to be experimentally determined .

How can CRISPR-Cas9 technology be optimized for studying KCS2 function?

CRISPR-Cas9 technology offers powerful approaches for investigating KCS2 function:

Optimized CRISPR-Cas9 Protocol for KCS2 Modification:

  • Guide RNA Design:

    • Target conserved catalytic domains for complete loss-of-function

    • Alternatively, target regulatory regions for expression modulation

    • Design multiple guides to increase editing efficiency

    • Avoid off-target effects through careful in silico prediction

  • Delivery Methods:

    • For Arabidopsis, floral dip transformation with Agrobacterium remains efficient

    • Consider protoplast transformation for rapid screening of guide efficiency

    • Implement ribonucleoprotein (RNP) delivery for transient editing experiments

  • Precise Modifications:

    • Create specific amino acid substitutions in catalytic residues

    • Engineer domain swaps between KCS2 and other KCS proteins

    • Introduce reporter tags for localization studies

    • Generate conditional alleles using inducible promoters

  • Screening Strategies:

    • Design PCR-based genotyping to detect intended modifications

    • Implement phenotypic screens based on cuticular wax appearance

    • Use targeted lipidomics to identify editing events affecting specific VLCFAs

    • Apply Sanger sequencing for confirmation of precise edits

CRISPR-Cas9 has been successfully employed to establish expression platforms for reconstituting different Arabidopsis FAE complexes in yeast, providing valuable insights into the functional characteristics of various KCS enzymes including KCS2 .

What novel analytical techniques can reveal the structural basis for KCS2 substrate specificity?

Advanced analytical techniques can provide deeper insights into the structural determinants of KCS2 substrate specificity:

  • Cryo-Electron Microscopy:

    • Generate high-resolution structures of KCS2 in different conformational states

    • Visualize enzyme-substrate complexes with various acyl-CoA chain lengths

    • Identify dynamic structural changes during catalysis

    • Resolution of 2.5-3.5 Å is typically sufficient to resolve key catalytic features

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map regions of KCS2 that undergo conformational changes upon substrate binding

    • Identify flexible domains that accommodate different substrate chain lengths

    • Compare dynamics between KCS2 and other KCS family members

    • Correlate structural flexibility with substrate preferences

  • Molecular Dynamics Simulations:

    • Model substrate access channels and binding pockets

    • Simulate interactions with various acyl-CoA substrates

    • Predict the energetic basis for chain-length preferences

    • Identify potential allosteric regulation sites

  • Site-Directed Mutagenesis Coupled with Activity Assays:

    • Create a library of mutations in putative substrate-binding residues

    • Systematically evaluate how mutations affect specificity for different chain lengths

    • Develop structure-function relationships for rational enzyme engineering

    • Identify residues that differentiate KCS2 from other family members

These techniques, when combined, can provide comprehensive mechanistic insights into how KCS2 achieves its distinct substrate preferences compared to other KCS enzymes, particularly its functional partner KCS20.

How can multi-omics approaches enhance our understanding of KCS2 function in plant stress responses?

Integrating multiple omics approaches provides a comprehensive view of KCS2 function during stress responses:

Multi-Omics Integration Strategy:

  • Transcriptomics:

    • RNA-seq analysis of wild-type vs. kcs2 mutants under stress conditions

    • Time-course experiments to capture dynamic responses

    • Cell-type specific transcriptomics to resolve tissue heterogeneity

    • Analysis of alternative splicing events affecting KCS2 expression

  • Proteomics:

    • Quantitative proteomics to measure KCS2 protein abundance changes

    • Phosphoproteomics to identify post-translational modifications

    • Protein-protein interaction studies to map the KCS2 interactome

    • Spatial proteomics to confirm subcellular localization during stress

  • Lipidomics:

    • Comprehensive profiling of VLCFA-containing lipids

    • Targeted analysis of cuticular waxes and suberin components

    • Flux analysis using stable isotope labeling

    • Spatial lipidomics to map lipid distribution in different tissues

  • Metabolomics:

    • Monitor changes in precursor and product metabolites

    • Identify novel compounds dependent on KCS2 activity

    • Measure stress-related metabolites correlated with KCS2 function

  • Phenomics:

    • High-throughput phenotyping under various stress conditions

    • Quantitative measurements of growth, water loss, and stress symptoms

    • Non-invasive imaging to track dynamic responses

Integration Framework:

  • Apply machine learning approaches to identify patterns across datasets

  • Develop network models connecting transcriptional changes to metabolic outcomes

  • Use Bayesian approaches to infer causal relationships

  • Implement multi-layer visualization tools to communicate complex relationships

This integrated approach has revealed that KCS2 expression is differentially controlled under osmotic stress conditions compared to its functional partner KCS20, suggesting specialized roles in stress adaptation despite their biochemical redundancy .

What strategies can overcome the challenges of studying KCS2 in complex with other fatty acid elongase components?

Studying KCS2 in the context of the complete fatty acid elongase complex presents significant challenges that can be addressed through specialized approaches:

  • Co-expression Systems:

    • Develop polycistronic expression constructs containing multiple elongase components

    • Establish stable transgenic lines expressing tagged versions of all complex components

    • Use inducible promoters to control stoichiometry of complex assembly

    • Implement Gateway cloning strategies for rapid generation of different component combinations

  • Affinity Purification Strategies:

    • Design epitope tags that preserve KCS2 functionality

    • Implement tandem affinity purification approaches for increased purity

    • Develop native extraction conditions that maintain complex integrity

    • Use crosslinking approaches to stabilize transient interactions

  • Structural Biology Approaches:

    • Apply single-particle cryo-EM for intact complex visualization

    • Implement integrative structural modeling using partial experimental data

    • Develop chemical crosslinking with mass spectrometry (XL-MS) to map interaction interfaces

    • Use hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Functional Reconstitution:

    • Establish liposome-based reconstitution of the complete elongase complex

    • Develop cell-free expression systems for simultaneous production of all components

    • Create synthetic membrane environments mimicking the native ER membrane

    • Implement activity assays for the reconstituted complex

These approaches can help overcome the inherent challenges of studying membrane-associated enzyme complexes and provide insights into how KCS2 functions within the larger molecular machinery of fatty acid elongation. Research has demonstrated that CRISPR-Cas9 technology can effectively establish expression platforms to reconstitute different Arabidopsis FAE complexes in yeast, providing valuable insights into their functional properties .

What are the most promising approaches for engineering KCS2 to enhance plant drought resistance?

Engineering KCS2 to enhance drought resistance represents a promising research direction with multiple strategic approaches:

  • Promoter Engineering:

    • Replace native promoter with drought-responsive elements

    • Implement synthetic promoters with optimized stress-induction profiles

    • Create tissue-specific expression systems targeting guard cells and epidermal tissues

    • Develop precision-regulated expression using orthogonal transcription systems

  • Protein Engineering:

    • Modify catalytic efficiency through rational design targeting rate-limiting steps

    • Alter substrate specificity to optimize VLCFA chain length distribution

    • Enhance protein stability under dehydration conditions

    • Create chimeric enzymes incorporating beneficial domains from other KCS family members

  • Pathway Engineering:

    • Coordinate KCS2 expression with other cuticular wax biosynthesis genes

    • Implement feedback-insensitive variants to overcome regulatory constraints

    • Develop synthetic protein scaffolds to enhance pathway flux

    • Create metabolic shunts to direct carbon flux toward VLCFA production during stress

  • Integration with Other Drought Response Mechanisms:

    • Coordinate with ABA signaling components

    • Connect to KAI2-dependent pathways that promote drought resistance

    • Link with stomatal regulation mechanisms

    • Integrate with other cuticular components that influence water retention

Research has shown that manipulation of cuticular wax composition through KCS2 and related genes can significantly impact plant water relations. The challenge is to engineer these pathways to enhance drought resistance without compromising other aspects of plant development or performance under normal conditions .

How might comparative analysis of KCS2 across diverse plant species inform evolutionary adaptation to environmental stresses?

Comparative analysis of KCS2 across diverse plant species provides valuable insights into evolutionary adaptations to environmental stresses:

Research Framework for Evolutionary Analysis:

  • Phylogenetic Profiling:

    • Construct comprehensive phylogenetic trees of KCS2 orthologs across plant lineages

    • Identify conserved domains versus rapidly evolving regions

    • Map adaptive mutations to functional domains

    • Correlate evolutionary rate with habitat conditions

  • Structure-Function Relationships:

    • Compare catalytic properties of KCS2 orthologs from diverse species

    • Identify sequence variations that correlate with substrate preferences

    • Examine differences in regulatory regions that affect expression patterns

    • Assess impact of sequence variations on protein-protein interactions

  • Ecological Correlation Studies:

    • Map KCS2 sequence diversity to ecological niches and climate zones

    • Correlate specific protein variants with adaptations to different stresses

    • Examine convergent evolution in unrelated species facing similar environmental challenges

    • Analyze KCS2 diversity in extremophile plant species

  • Experimental Validation:

    • Express KCS2 variants from diverse species in a common genetic background

    • Test functional complementation across species boundaries

    • Evaluate stress tolerance conferred by different orthologs

    • Perform site-directed mutagenesis to confirm adaptive mutations

This approach would reveal how KCS2 has evolved to meet diverse environmental challenges across plant lineages and could identify naturally optimized variants with enhanced functionality under specific stress conditions.

What methodology would best assess the potential interaction between KCS2 and drought-responsive signaling pathways like KAI2?

To investigate potential interactions between KCS2 and drought-responsive signaling pathways like KAI2, a multi-faceted methodological approach is recommended:

  • Genetic Interaction Analysis:

    • Generate kcs2 kai2 double mutants and characterize their drought phenotypes

    • Create higher-order mutants with additional components of both pathways

    • Implement CRISPR interference (CRISPRi) for conditional knockdown experiments

    • Develop genetic suppressor screens to identify additional pathway components

  • Transcriptional Regulation Analysis:

    • Perform chromatin immunoprecipitation (ChIP-seq) to identify transcription factors binding to KCS2 promoter

    • Use yeast one-hybrid assays to screen for regulators of KCS2 expression

    • Implement promoter-reporter fusions to monitor KCS2 expression in various signaling mutants

    • Conduct time-course expression studies following karrikin application

  • Biochemical Interaction Studies:

    • Perform co-immunoprecipitation experiments to detect physical interactions

    • Use split-ubiquitin yeast two-hybrid assays suitable for membrane proteins

    • Implement proximity labeling approaches (BioID, TurboID) to identify near-neighbors

    • Apply förster resonance energy transfer (FRET) microscopy to detect interactions in vivo

  • Physiological Response Integration:

    • Monitor cuticular wax composition changes in response to karrikin application

    • Analyze stomatal responses in various genetic backgrounds

    • Measure water loss rates and drought survival in pathway mutants

    • Assess cell membrane damage during drought stress across genotypes

Research has demonstrated that KAI2 signaling promotes drought resistance in Arabidopsis while KCS2 contributes to cuticular wax and suberin biosynthesis that affects water retention . Investigating the molecular interface between these pathways could reveal novel integrated stress response mechanisms and provide targets for enhancing drought resilience.

What are the critical quality control checkpoints for recombinant KCS2 expression and purification?

To ensure high-quality recombinant KCS2 for research applications, implement these critical quality control checkpoints:

Expression QC Protocol:

  • Pre-Expression Verification:

    • Sequence verification of expression construct

    • Confirmation of reading frame and tag orientation

    • Verification of promoter and terminator integrity

    • Assessment of codon optimization for expression system

  • Expression Monitoring:

    • Western blot analysis with KCS2-specific antibodies

    • Quantitative PCR for transcript level verification

    • Growth curve analysis to identify toxicity effects

    • Microscopy for subcellular localization in expression system

  • Functional Verification:

    • Small-scale activity assays prior to large-scale purification

    • Lipid profile analysis of expression system

    • Comparison with positive control (known active KCS)

    • Assessment of substrate incorporation in expression system

Purification QC Checkpoints:

  • Purity Assessment:

    • SDS-PAGE with silver staining (target >90% purity)

    • Mass spectrometry for protein identification

    • Size exclusion chromatography to verify monodispersity

    • Dynamic light scattering for aggregation analysis

  • Activity Assessment:

    • Specific activity measurements with preferred substrates

    • Thermal stability assays to verify proper folding

    • Circular dichroism to confirm secondary structure

    • Comparative activity with native membrane preparations

  • Storage Stability:

    • Activity retention after freeze-thaw cycles

    • Shelf-life determination under various storage conditions

    • Detergent exchange compatibility for downstream applications

    • Liposome reconstitution efficiency tests

Implementing these checkpoints ensures that experimental results obtained with recombinant KCS2 are reliable and reproducible across different research applications.

How can researchers effectively distinguish between the functional contributions of KCS2 versus KCS20 in stress responses?

Distinguishing the specific contributions of KCS2 versus KCS20 in stress responses requires specialized experimental approaches:

  • Temporal Expression Analysis:

    • Implement high-resolution time-course experiments following stress application

    • Use RT-qPCR to track expression patterns of both genes

    • Employ promoter-reporter constructs for in vivo visualization

    • Compare expression dynamics across multiple stresses (drought, salinity, heat)

  • Protein-Level Regulation:

    • Develop specific antibodies to distinguish between KCS2 and KCS20

    • Monitor protein abundance, stability, and turnover rates

    • Assess post-translational modifications under stress conditions

    • Examine protein localization changes during stress progression

  • Substrate Utilization Profiling:

    • Perform in vitro enzyme assays with recombinant proteins

    • Conduct in vivo metabolic labeling under stress conditions

    • Compare VLCFA profiles in single and double mutants

    • Analyze substrate competition between KCS2 and KCS20

  • Gene-Specific Manipulation:

    • Create inducible RNAi lines for temporal control of gene silencing

    • Develop gene-specific CRISPR interference constructs

    • Implement tissue-specific knockout strategies

    • Design chimeric constructs swapping regulatory regions between genes

Research has shown that while KCS2 and KCS20 are functionally redundant in biosynthetic terms, their expression is differentially controlled under osmotic stress conditions . This differential regulation suggests distinct roles in stress adaptation that can be further elucidated through the approaches outlined above.

What analytical pipeline best characterizes the complete VLCFA profile changes in KCS2-modified plants?

An optimal analytical pipeline for comprehensive characterization of VLCFA profiles in KCS2-modified plants includes:

Sample Preparation:

  • Tissue-Specific Extraction:

    • Separate analysis of epidermis, mesophyll, and roots

    • Microdissection of specific cell types where applicable

    • Developmental stage-specific sampling

    • Stress-induced versus basal condition comparison

  • Fractionation:

    • Separate free fatty acids, waxes, and suberin components

    • Isolate different lipid classes (phospholipids, sphingolipids, etc.)

    • Perform sequential extraction for comprehensive coverage

    • Prepare appropriate internal standards for each fraction

Analytical Methods:

  • Chromatography:

    • Ultra-high performance liquid chromatography (UHPLC)

    • Gas chromatography with flame ionization detection (GC-FID)

    • Silver ion chromatography for separation of unsaturated species

    • Chiral chromatography for stereoisomer differentiation

  • Mass Spectrometry:

    • High-resolution accurate mass (HRAM) analysis

    • Tandem MS/MS for structural confirmation

    • Multiple reaction monitoring for targeted quantification

    • Ion mobility separation for isomer discrimination

Data Processing:

  • Quantification:

    • Absolute quantification using calibration curves

    • Relative quantification for large-scale comparisons

    • Chain-length distribution analysis

    • Saturation index calculation

  • Statistical Analysis:

    • Principal component analysis for pattern recognition

    • Hierarchical clustering to identify co-regulated species

    • Pathway enrichment analysis for mechanistic insights

    • Time-series analysis for dynamic responses

This comprehensive pipeline allows researchers to detect subtle changes in VLCFA profiles that might be missed by less sophisticated approaches. Research has shown that kcs20 kcs2/daisy-1 double mutants exhibit significant reduction of C22 and C24 VLCFA derivatives but accumulation of C20 VLCFA derivatives in aliphatic suberin , highlighting the importance of chain-length-specific analysis.

How can knowledge of KCS2 function inform strategies for improving crop drought resilience?

Translating KCS2 research to crop improvement strategies requires several considerations:

  • Ortholog Identification and Validation:

    • Identify functional KCS2 orthologs in target crop species

    • Validate functional conservation through complementation studies

    • Assess expression patterns in key tissues related to water conservation

    • Evaluate genetic diversity of KCS2 orthologs within crop germplasm

  • Phenotypic Impact Assessment:

    • Evaluate water use efficiency in KCS2-modified crop plants

    • Measure cuticular permeability and transpiration rates

    • Assess yield stability under water-limited conditions

    • Quantify drought survival rates and recovery potential

  • Breeding and Engineering Strategies:

    • Develop molecular markers for beneficial KCS2 alleles

    • Implement targeted mutagenesis to optimize cuticular properties

    • Create transgenic overexpression lines with stress-inducible promoters

    • Stack KCS2 modifications with other drought-tolerance traits

  • Integration with Agricultural Practices:

    • Determine optimal irrigation schedules for KCS2-modified crops

    • Assess performance under different climate scenarios

    • Evaluate interactions with agricultural chemicals

    • Develop management recommendations for maximal drought resilience

Research has demonstrated that KCS2 influences drought adaptation through effects on cuticular wax and suberin biosynthesis, which directly impacts water retention capabilities . Additionally, the connection to signaling pathways that promote drought resistance, such as KAI2-dependent signaling , provides further opportunities for enhancing crop resilience through integrated approaches.

What experimental design would best evaluate the impact of KCS2 modifications on plant water use efficiency?

A comprehensive experimental design to evaluate water use efficiency (WUE) in KCS2-modified plants should include:

Controlled Environment Studies:

  • Gas Exchange Measurements:

    • Measure leaf-level transpiration, photosynthesis, and stomatal conductance

    • Calculate instantaneous WUE (photosynthesis/transpiration)

    • Perform diurnal measurements to capture temporal variations

    • Compare responses to vapor pressure deficit (VPD) gradients

  • Whole-Plant Water Relations:

    • Implement gravimetric water loss measurements

    • Monitor plant water status (water potential, relative water content)

    • Measure hydraulic conductance in stems and roots

    • Assess root architecture and water uptake capacity

  • Molecular and Biochemical Parameters:

    • Quantify cuticular wax composition and abundance

    • Measure cuticular permeability using dye penetration assays

    • Analyze ABA content and signaling components

    • Assess stomatal density and responsiveness

Field Trials:

  • Productivity Assessments:

    • Measure biomass accumulation and partitioning

    • Evaluate yield components under different water regimes

    • Calculate long-term WUE (biomass/water consumed)

    • Assess harvest index as indicator of productive water use

  • Drought Response Monitoring:

    • Implement controlled drought cycles

    • Measure recovery capacity after drought

    • Monitor physiological stress indicators

    • Evaluate reproductive stage drought tolerance

  • Advanced Phenotyping:

    • Deploy high-throughput field phenotyping platforms

    • Use thermal imaging to assess canopy temperature

    • Implement spectral reflectance measurements

    • Monitor soil moisture depletion patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.