Recombinant Arabidopsis thaliana Probable aquaporin PIP2-4 (PIP2-4)

Shipped with Ice Packs
In Stock

Description

Classification of Plant Aquaporins

Aquaporins are membrane channel proteins that facilitate the transport of water and small neutral solutes across biological membranes. In plants, aquaporins play crucial roles in maintaining water homeostasis, nutrient uptake, and responses to environmental stresses. The model plant Arabidopsis thaliana possesses approximately 35 aquaporin genes classified into four major subfamilies: Plasma membrane Intrinsic Proteins (PIPs), Tonoplast Intrinsic Proteins (TIPs), Nodulin26-like Intrinsic Proteins (NIPs), and Small basic Intrinsic Proteins (SIPs) . This diversity reflects the complexity of water and solute transport mechanisms in plant cells and their importance in plant physiology.

The PIP2 Subfamily

The PIP subfamily, located in the plasma membrane, represents the largest plant aquaporin subfamily and is further divided into two subgroups: PIP1 and PIP2. Arabidopsis thaliana contains five PIP1 and eight PIP2 members . The PIP2 subgroup members are generally characterized by high water channel activity when tested in heterologous systems, whereas PIP1 proteins often show lower activity or are inactive . The PIP2 proteins differ in their expression patterns, substrate specificity, and physiological roles, suggesting non-redundant functions despite sequence similarities.

Molecular Identity of PIP2-4

PIP2-4 (AtPIP2;4) is encoded by the gene At5g60660 (alternative designation: MUP24.9) in the Arabidopsis genome . The protein is also known as Plasma membrane intrinsic protein 2.4 or AtPIP2;4. The UniProt database identifies this protein with the accession number Q9FF53 . PIP2-4 belongs to the PIP2 subgroup and shares structural features characteristic of aquaporins, including six transmembrane domains and the NPA (Asparagine-Proline-Alanine) motifs that form the water-selective pore.

Tissue-Specific Expression

PIP2-4 stands out among the PIP2 subfamily members due to its distinctive expression pattern. While other PIP2 members show more widespread expression throughout the plant, PIP2-4 is uniquely root-specific . This specialized expression pattern suggests a specific role in root water uptake or transport processes. In contrast, other PIP2 members such as PIP2;5 and PIP2;7 are more uniformly found in leaves, while PIP2;2 is highly expressed throughout the plant .

Cellular and Subcellular Localization

Studies using green fluorescent protein (GFP) fusion constructs have confirmed the plasma membrane localization of PIP2-4 . This subcellular localization is consistent with its classification as a plasma membrane intrinsic protein and its proposed function in mediating water and solute transport across the plasma membrane. The root-specific expression combined with plasma membrane localization positions PIP2-4 as a potential key player in controlling water uptake from the soil and possibly regulating root hydraulic conductivity.

Expression Regulation

Expression analysis using promoter::GUS fusions and microarray data have revealed differential expression patterns of PIP2 members in response to various environmental stimuli and developmental stages . These studies help to elucidate the specific roles of individual PIP2 proteins, including PIP2-4, in plant water relations and stress responses. The root-specific expression of PIP2-4 may be particularly important during water deficit conditions or in response to changes in soil water potential.

Role in Water Transport and Plant Water Status

The primary function of aquaporins is to facilitate water transport across membranes, and PIP2-4, as a member of the PIP2 subfamily, likely contributes significantly to this process in roots. Studies with pip2;4 knockout mutants suggest that this protein plays a role in maintaining plant water status . The increased stomatal conductance and whole-plant transpiration observed in pip2;4 mutants under low humidity conditions indicate that PIP2-4 may be involved in regulating water loss and potentially in long-distance water transport from roots to shoots.

Contribution to Photosynthesis and Gas Exchange

Research on pip2;4 knockout mutants has revealed surprising connections between PIP2-4 function and photosynthetic parameters. Under low humidity conditions, pip2;4 mutants exhibited 44% higher stomatal conductance (gs) than wild-type plants, which consequently resulted in an increased net photosynthetic rate (Anet) . Additionally, these mutants showed a 23% increase in whole-plant transpiration (E) . These findings suggest that PIP2-4 may indirectly influence photosynthesis by regulating water availability and stomatal behavior, potentially acting as a negative regulator of stomatal opening.

Potential Role in Hydrogen Peroxide Transport

Recent studies have indicated that some PIP2 isoforms may transport hydrogen peroxide (H2O2) in addition to water . H2O2 is an important signaling molecule in plants, involved in stress responses and developmental processes. While initially believed to be specific to water transport, certain PIP2 aquaporins, including potentially PIP2-4, might facilitate H2O2 diffusion across plasma membranes . This function would implicate PIP2-4 in oxidative stress signaling and responses, particularly in root tissues where it is predominantly expressed.

Expression Systems and Purification

Recombinant PIP2-4 protein can be successfully expressed in bacterial systems, particularly in Escherichia coli. The full-length protein (amino acids 1-291) is typically expressed with an N-terminal His-tag to facilitate purification . Following expression, the protein can be purified using affinity chromatography, yielding a product with greater than 90% purity as determined by SDS-PAGE .

Applications of Recombinant PIP2-4

The availability of purified recombinant PIP2-4 protein enables various research applications, including:

  1. Structural studies to understand the molecular architecture of plant aquaporins

  2. Functional assays to characterize water and solute transport activities

  3. Development of antibodies for immunolocalization and protein detection

  4. Protein-protein interaction studies to identify regulatory partners

  5. In vitro reconstitution experiments to study transport mechanisms

Phenotypic Analysis of pip2;4 Mutants

Studies using T-DNA insertion mutants have provided valuable insights into the physiological functions of PIP2-4. The pip2;4 knockout mutants have been characterized for various parameters, including growth, water relations, and gas exchange . The most significant findings from these studies are summarized in Table 2.

Table 2: Phenotypic Differences between pip2;4 Knockout Mutants and Wild-Type Plants

ParameterConditionEffect in pip2;4 MutantReference
Stomatal conductance (gs)Low humidity44% increase
Net photosynthetic rate (Anet)Low humiditySignificant increase
Whole-plant transpiration (E)Low humidity23% increase
Stomatal conductance (gs)High humidityMinimal effect
Root-specific water transportStandard conditionsAltered

Insights from Multiple Knockout Studies

Research has also investigated the effects of knocking out multiple PIP genes simultaneously. Double mutants (pip2;2x2;4, pip2;4x2;5) and triple mutants (pip2;2x2;4x2;5) have been created to examine potential functional redundancy or synergistic effects between different PIP2 members . These studies help to untangle the complex roles of individual aquaporins within the larger water transport network in plants. The analysis of these multiple knockouts provides a more comprehensive understanding of how different PIP2 proteins work together to maintain plant water status under various environmental conditions.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
PIP2-4; At5g60660; MUP24.9; Probable aquaporin PIP2-4; Plasma membrane intrinsic protein 2.4; AtPIP2;4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PIP2-4
Target Protein Sequence
MAKDLDVNESGPPAARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGSFGSFRSFA
Uniprot No.

Target Background

Function
Aquaporins facilitate the transmembrane transport of water and small, neutral solutes.
Database Links

KEGG: ath:AT5G60660

STRING: 3702.AT5G60660.1

UniGene: At.22996

Protein Families
MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots.

Q&A

What is Arabidopsis thaliana Probable aquaporin PIP2-4 and what is its significance in plant physiology?

Arabidopsis thaliana Probable aquaporin PIP2-4 belongs to the plasma membrane intrinsic protein (PIP) subfamily of aquaporins. It is one of the 35 different aquaporin isoforms identified in Arabidopsis thaliana, which are divided into four subfamilies based on their sequence homology and subcellular localization . PIP2-4, like other PIP2-type aquaporins, plays a crucial role in water transport across cellular membranes and may be involved in CO₂ transport that affects photosynthetic efficiency. Research has demonstrated that PIP2-type aquaporins contribute significantly to both stomatal conductance of water vapor (g​s) and mesophyll conductance of CO₂ (g​m), thus directly influencing photosynthetic rates .

How do PIP2-type aquaporins differ structurally and functionally from other aquaporins in Arabidopsis thaliana?

PIP2-type aquaporins, including PIP2-4, are characterized by specific structural features that distinguish them from other aquaporin subfamilies. These proteins typically contain six transmembrane domains with cytosolic N- and C-termini and form tetramers in the plasma membrane. Functionally, PIP2 aquaporins generally exhibit higher water transport activity compared to PIP1 aquaporins and play distinct roles in plant water relations and gas exchange. Studies with knockout mutants have revealed that different PIP2 isoforms have specialized physiological functions, with PIP2-4 particularly influential in regulating stomatal conductance under specific environmental conditions .

What expression patterns does PIP2-4 show in different Arabidopsis tissues and developmental stages?

PIP2-4 shows tissue-specific and developmentally regulated expression patterns in Arabidopsis thaliana. While the provided search results don't detail the specific expression pattern of PIP2-4, research approaches typically include qRT-PCR analysis, promoter-reporter gene fusions, and immunolocalization techniques to characterize aquaporin expression. These methods have revealed that PIP2-type aquaporins often show differential expression in response to environmental stresses such as drought, salinity, and varying humidity conditions. The functional significance of PIP2-4 has been studied using T-DNA insertion knockout mutants, which allow researchers to assess its physiological roles in specific tissues and under various environmental conditions .

What are the recommended protocols for expressing and purifying recombinant Arabidopsis thaliana PIP2-4 protein?

For the expression and purification of recombinant Arabidopsis thaliana PIP2-4, researchers typically use bacterial expression systems, particularly E. coli, similar to the approach used for other aquaporins . A common methodology involves:

  • Cloning the full-length PIP2-4 gene (coding for all amino acids) into an expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using nickel affinity chromatography

  • Further purification steps may include size exclusion chromatography

The purified protein is typically obtained as a lyophilized powder and should be stored at -20°C/-80°C. For reconstitution, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles, which can compromise protein integrity

How can researchers effectively generate and validate PIP2-4 knockout mutants in Arabidopsis thaliana?

To generate and validate PIP2-4 knockout mutants in Arabidopsis thaliana, researchers should follow these methodological approaches:

  • Obtain T-DNA insertion lines: T-DNA insertion lines for PIP2-4 can be acquired from repositories such as the Nottingham Arabidopsis Stock Centre (NASC) .

  • Genotyping and validation:

    • Perform PCR-based genotyping to confirm T-DNA insertion and identify homozygous plants

    • Design gene-specific primers flanking the insertion site and combine with T-DNA border primers

    • Sequence the PCR products to confirm the exact insertion site

  • Expression analysis:

    • Conduct RT-PCR or qRT-PCR to verify the absence of functional transcript

    • Perform Western blot analysis using specific antibodies if available

  • Generation of multiple knockout lines:

    • Cross validated single mutants to create double or triple mutants as needed for functional redundancy studies

    • Screen progeny through additional rounds of genotyping

What methods are most effective for studying PIP2-4 localization and trafficking in plant cells?

For studying PIP2-4 localization and trafficking in plant cells, researchers can employ the following complementary approaches:

  • Fluorescent protein fusions:

    • Generate C- or N-terminal fusions of PIP2-4 with fluorescent proteins (GFP, YFP, mCherry)

    • Express in Arabidopsis through stable transformation or protoplast transient expression

    • Analyze using confocal laser scanning microscopy

  • Immunolocalization:

    • Develop specific antibodies against PIP2-4 or use epitope-tagged versions

    • Fix and permeabilize plant tissues or cells

    • Perform immunostaining with fluorescent secondary antibodies

    • Analyze using confocal or super-resolution microscopy

  • Biochemical fractionation:

    • Isolate different membrane fractions (plasma membrane, intracellular vesicles)

    • Detect PIP2-4 distribution using immunoblotting

    • Compare protein abundance across fractions to determine subcellular distribution

  • Trafficking studies:

    • Use brefeldin A or other inhibitors to block specific trafficking pathways

    • Employ photoconvertible fluorescent proteins to track protein movement over time

    • Analyze co-localization with known markers of different cellular compartments

How does PIP2-4 contribute to photosynthetic efficiency in Arabidopsis thaliana?

PIP2-4 contributes to photosynthetic efficiency in Arabidopsis thaliana through multiple mechanisms:

  • Regulation of stomatal conductance: Studies with pip2;4 knockout mutants have shown a 44% higher stomatal conductance (gs) than wild-type plants under low humidity conditions. This increased gas exchange capacity directly resulted in enhanced net photosynthetic rates (Anet) .

  • Impact on water transport: The pip2;4 knockout mutant demonstrated a 23% increase in whole-plant transpiration (E), suggesting PIP2-4's role in regulating water movement through the plant, which indirectly affects photosynthetic capacity .

  • Environmental response modulation: The contribution of PIP2-4 to stomatal conductance was found to be larger under low air humidity conditions (high evaporative demand), while its effect was minimal under higher humidity. This indicates PIP2-4's participation in adaptive responses to environmental changes .

This functional characterization demonstrates that PIP2-4 serves as a negative regulator of stomatal conductance, particularly under water-limiting conditions, highlighting its importance in optimizing water use efficiency while maintaining photosynthetic capacity.

What interactions between PIP2-4 and other membrane components have been identified?

While the search results don't provide specific information about PIP2-4 interactions with other membrane components, research on PIP2-type lipids and aquaporins suggests several potential interaction mechanisms:

  • Lipid-protein interactions: PIP2 (phosphatidylinositol 4,5-bisphosphate) as a plasma membrane lipid can interact with and regulate membrane proteins, including ion channels and potentially aquaporins . This suggests that similar regulatory mechanisms might affect PIP2-4 function through lipid-protein interactions within the membrane.

  • Protein-protein interactions: Aquaporins often form heterotetramers with other aquaporin isoforms, which can influence their trafficking, stability, and function. These interactions may be crucial for proper PIP2-4 localization and activity.

  • Regulatory protein binding: The activity and abundance of aquaporins can be regulated through interactions with regulatory proteins that may bind to cytosolic domains, affecting channel gating or membrane trafficking.

Further research using techniques such as co-immunoprecipitation, FRET analysis, or yeast two-hybrid screens would be valuable to identify specific interaction partners of PIP2-4 in Arabidopsis membranes.

How do environmental stresses affect PIP2-4 expression and function?

Environmental stresses significantly impact PIP2-4 expression and function, with distinct responses observed under different conditions:

  • Humidity effects: Research has demonstrated that PIP2-4's contribution to plant water relations is strongly dependent on air humidity levels. The functional significance of PIP2-4 becomes more pronounced under low humidity conditions, where it helps regulate stomatal conductance and transpiration rates .

  • Drought response: While specific data for PIP2-4 is not provided in the search results, studies with PIP2-type aquaporins often show transcriptional and post-translational regulation in response to water deficit, suggesting PIP2-4 likely participates in drought adaptation mechanisms.

  • Integration with signaling pathways: The activity of aquaporins like PIP2-4 is likely coordinated with cellular signaling cascades, potentially involving regulatory pathways similar to those observed with PIP2 lipid regulation of ion channels .

Understanding these environmental response mechanisms is crucial for interpreting the physiological roles of PIP2-4 in plant stress adaptation and for designing experiments that accurately assess its function under relevant conditions.

What are the current challenges and solutions in developing functional assays for recombinant PIP2-4 activity?

Developing functional assays for recombinant PIP2-4 activity presents several challenges and potential solutions:

Challenges:

  • Maintaining protein integrity during purification and reconstitution

  • Establishing physiologically relevant membrane environments

  • Distinguishing between water and CO₂ transport activities

  • Quantifying transport rates accurately

Solutions:

  • Proteoliposome-based assays:

    • Reconstitute purified PIP2-4 into liposomes of defined lipid composition

    • Measure water transport using stopped-flow spectroscopy with osmotic gradients

    • Assess CO₂ permeability using pH-sensitive fluorescent dyes

  • Heterologous expression systems:

    • Express PIP2-4 in Xenopus oocytes to measure water permeability

    • Use yeast complementation assays to assess functionality

    • Employ mammalian cell expression for trafficking studies

  • Native membrane vesicle isolation:

    • Isolate plasma membrane vesicles from plants expressing tagged PIP2-4

    • Perform transport assays in these native membrane environments

    • Compare wild-type and mutant protein activities

For protein handling, researchers should follow specific protocols to maintain stability, including storing the protein at -20°C/-80°C, avoiding repeated freeze-thaw cycles, reconstituting in appropriate buffers, and adding stabilizing agents like glycerol .

How can advanced imaging techniques be applied to study PIP2-4 dynamics in planta?

Advanced imaging techniques offer powerful approaches for studying PIP2-4 dynamics in living plants:

  • Single-molecule imaging:

    • Track individual PIP2-4 molecules tagged with photoactivatable fluorescent proteins

    • Analyze diffusion coefficients and clustering behavior within the membrane

    • Identify microdomains or restrictions to lateral mobility

  • Expansion microscopy (ExM):

    • Similar to techniques used for other membrane proteins , ExM can physically expand plant tissue samples

    • Achieve super-resolution imaging using standard confocal microscopes

    • Visualize nanoscale organization of PIP2-4 relative to other membrane components

  • FRET/FLIM analysis:

    • Generate donor-acceptor pairs with PIP2-4 and potential interaction partners

    • Measure energy transfer to quantify molecular proximities

    • Determine conformational changes during channel gating

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging of tagged PIP2-4 with electron microscopy

    • Achieve high-resolution structural context for functional observations

    • Visualize membrane ultrastructure associated with PIP2-4 clusters

These techniques can reveal dynamic aspects of PIP2-4 function that are difficult to assess using traditional biochemical approaches, providing insights into how these aquaporins respond to environmental stimuli and interact with other cellular components.

What are the implications of PIP2-4 research for improving crop water use efficiency and drought tolerance?

The research on PIP2-4 and related aquaporins has significant implications for crop improvement strategies:

  • Targeted genetic engineering approaches:

    • Modifying PIP2-4 expression levels or activity could potentially enhance plant water use efficiency

    • The finding that pip2;4 knockout mutants exhibit higher stomatal conductance and photosynthetic rates suggests that fine-tuning PIP2-4 expression could optimize the balance between water conservation and carbon fixation

  • Breeding selection criteria:

    • Identifying natural variants of PIP2-4 with altered functional properties

    • Developing markers for optimal PIP2-4 alleles for different environmental conditions

    • Integrating PIP2-4 genotyping into drought tolerance breeding programs

  • Environmental adaptation strategies:

    • Understanding how PIP2-4 responds to varying humidity conditions can inform irrigation management

    • The differential response of PIP2-4 function under different humidity regimes suggests targeted approaches for specific growing environments

  • Integrative physiological considerations:

    • Beyond single gene effects, research on PIP2-4 highlights the importance of considering transport protein networks

    • The creation and analysis of multiple knockout lines (double and triple mutants) demonstrates the complex interactions between different aquaporin isoforms

Future research should focus on translating findings from Arabidopsis to crop species, determining whether orthologous PIP2-4 proteins function similarly in agricultural plants, and developing practical applications for manipulating aquaporin activity in field conditions.

What are common issues encountered when working with recombinant PIP2-4 and how can they be resolved?

Researchers working with recombinant PIP2-4 protein commonly encounter several challenges that can be addressed through specific methodological approaches:

ChallengePotential CausesSolutions
Low expression yieldProtein toxicity, codon bias, inclusion body formationUse specialized E. coli strains, optimize codon usage, lower induction temperature, add solubility tags
Protein aggregationImproper folding, hydrophobic interactions, concentration effectsInclude glycerol in buffers, optimize detergent types and concentrations, avoid repeated freeze-thaw cycles
Loss of functionalityDenaturation during purification, improper reconstitutionUse mild solubilization conditions, validate protein structure by circular dichroism, optimize reconstitution protocols
Storage instabilityProteolytic degradation, oxidation, freeze-thaw damageAdd protease inhibitors, store in aliquots at -80°C, include glycerol (5-50%) , use lyophilization for long-term storage

For handling recombinant PIP2-4:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Store working aliquots at 4°C for no more than one week

  • For long-term storage, add glycerol and keep at -20°C/-80°C

How can researchers accurately quantify PIP2-4 expression levels in plant tissues?

Accurate quantification of PIP2-4 expression in plant tissues requires a combination of techniques, each with specific advantages:

  • Transcript quantification:

    • qRT-PCR with gene-specific primers designed to distinguish PIP2-4 from other aquaporin family members

    • RNA-Seq analysis for genome-wide expression patterns

    • Northern blotting for validation of transcript size and abundance

  • Protein quantification:

    • Western blotting with PIP2-4-specific antibodies

    • Mass spectrometry-based proteomics for absolute quantification

    • ELISA assays for high-throughput analysis

  • Tissue-specific expression:

    • Laser capture microdissection coupled with qRT-PCR

    • Reporter gene constructs (GUS, GFP) driven by the PIP2-4 promoter

    • Single-cell RNA-Seq for cell-type-specific expression patterns

For reliable results, researchers should:

  • Include appropriate housekeeping genes as references

  • Validate antibody specificity using knockout mutants

  • Consider post-translational modifications that may affect detection

  • Account for environmental conditions that influence expression

What considerations are important when designing experiments to study PIP2-4 interactions with membrane lipids?

When designing experiments to study PIP2-4 interactions with membrane lipids, several important considerations should be addressed:

  • Lipid composition effects:

    • The plasma membrane contains diverse lipids that may influence aquaporin function

    • PIP2 (phosphatidylinositol 4,5-bisphosphate) and other phosphoinositides can modulate membrane protein activity

    • Experiments should consider both bulk lipid effects and specific lipid-protein interactions

  • Methodological approaches:

    • Liposome binding assays with varying lipid compositions

    • Surface plasmon resonance to measure binding kinetics

    • Native mass spectrometry to identify bound lipids

    • Molecular dynamics simulations to predict interaction sites

  • Functional validation:

    • Correlate lipid binding with functional changes in water/CO₂ transport

    • Assess the impact of lipid environment alterations on channel gating

    • Consider how lipid modifications during stress responses affect PIP2-4 activity

  • PIP2 metabolism considerations:

    • The cellular levels of phosphoinositides like PIP2 are dynamic and influenced by lipid kinases and phosphatases

    • Experimental designs should account for potential changes in lipid composition during experimental manipulations

    • Tools to manipulate specific lipid levels (such as inducible lipid kinases or phosphatases) can help establish causality

Understanding these interactions may provide insights into how membrane lipid composition changes during environmental stress could modulate PIP2-4 function in plant adaptive responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.