Recombinant Arabidopsis thaliana Probable aquaporin TIP2-2 (TIP2-2)

Shipped with Ice Packs
In Stock

Description

Gene Characterization and Subcellular Localization

TIP2;2 is encoded by the TIP2;2 gene (At5g47450) in Arabidopsis and is classified as a member of the TIP2 subgroup within the TIP family . Key features include:

ParameterDetail
Gene IDAt5g47450
Protein Length~250 amino acids (similar to other TIP family members)
Subcellular LocationTonoplast membrane in root cells
FunctionFacilitates water and solute transport (e.g., ammonia, urea)
Light ResponsivenessmRNA levels increase during dark adaptation; protein levels decrease under far-red light

Localization Studies:
TIP2;2-GFP fusion proteins localized predominantly to the tonoplast membrane in root endodermal cells, suggesting a role in vacuolar compartmentalization and solute management .

Functional Roles in Stress and Solute Transport

TIP2;2 is implicated in:

  • Water Transport: Regulates osmotic balance in roots, particularly under dark conditions.

  • Ammonia and Urea Permeability: Similar to other TIP2 isoforms, TIP2;2 may facilitate ammonia transport, influencing nitrogen metabolism .

Key Experimental Insights:

  • Dark Adaptation: TIP2;2 mRNA and protein levels rise in roots during prolonged darkness, a response partially mediated by phytochrome A (phyA) .

  • Light Suppression: Far-red light rapidly reduces TIP2;2-GFP fluorescence in wild-type plants, but this effect is delayed in phyA mutants, indicating phyA-dependent regulation .

Light Regulation and Phytochrome A Dependency

TIP2;2 expression is tightly controlled by light signals, with phyA playing a central role:

ConditionWild-Type ResponsephyA Mutant Response
Dark AdaptationTIP2;2-GFP fluorescence increasesNo fluorescence increase
Far-Red LightRapid decrease in TIP2;2-GFPDelayed reduction of TIP2;2-GFP

Mechanistic Insights:

  • Transcriptional and Post-Transcriptional Control:

    • PhyA regulates TIP2;2 at both mRNA and protein levels.

    • Light quality (far-red) triggers protein degradation pathways .

  • Cross-Talk with Other Photoreceptors: PhyA likely interacts with other photoreceptors (e.g., phyB, cry1) to modulate TIP2;2 dynamics under diverse light regimes .

TIP2;2-GFP Transgenic Studies

Transgenic Arabidopsis expressing TIP2;2-GFP under its native promoter revealed:

  1. Tissue-Specific Expression: Strong fluorescence in root endodermis, correlating with vacuolar membrane localization .

  2. Stress Adaptation: Enhanced TIP2;2 accumulation under dark conditions may mitigate osmotic stress in roots .

PhyA Mutant Analysis

PhenotypeWild-TypephyA Mutant
Dark-Induced TIP2;2Accumulation observedNo accumulation
Far-Red Light ResponseRapid TIP2;2 degradationDelayed degradation

Implications:

  • Adaptive Mechanism: TIP2;2 modulates vacuolar osmotic potential to support root growth in dark environments.

  • Signaling Complexity: PhyA-independent pathways may partially compensate for TIP2;2 regulation under far-red light .

Future Directions and Unanswered Questions

  • Functional Redundancy: How TIP2;2 interacts with other TIP isoforms (e.g., TIP1;1, TIP2;1) in coordinating chloroplast or vacuolar function.

  • Ecophysiological Relevance: Roles in ammonia detoxification or drought tolerance remain unexplored.

  • Post-Translational Modifications: Potential phosphorylation or ubiquitination sites affecting TIP2;2 stability or activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIP2-2; At4g17340; dl4705w; FCAALL.412; Probable aquaporin TIP2-2; Tonoplast intrinsic protein 2-2; AtTIP2;2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIP2-2
Target Protein Sequence
MVKIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPAPTTESYP
Uniprot No.

Target Background

Function
Aquaporins facilitate the transmembrane transport of water and small neutral solutes.
Database Links

KEGG: ath:AT4G17340

STRING: 3702.AT4G17340.1

UniGene: At.24274

Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Expressed above groung and in roots.

Q&A

What is TIP2-2 and how does it differ from other TIP family aquaporins?

TIP2-2 is an isoform in the tonoplast intrinsic protein subfamily of aquaporins that facilitates vacuolar membrane transport of water and other solutes in Arabidopsis thaliana . Unlike some other TIP family members such as TIP1;1 (primarily envelope-localized), TIP1;2 (envelope and thylakoid-localized), and TIP2;1 (thylakoid-localized), TIP2-2 has been observed in structures reminiscent of both the plasma membrane and vacuole . TIP2-2 also has a distinct expression pattern, being highly expressed in the cortex of the elongation zone of the main root and mature lateral roots, but notably absent from lateral root primordia or early developing lateral roots .

What are the primary cellular localizations of TIP2-2?

TIP2-2 exhibits a dual localization pattern within plant cells. Microscopy studies using TIP2;2::GFP translational fusions have demonstrated that this aquaporin localizes to both the tonoplast (vacuolar membrane) and the plasma membrane . This dual localization has been confirmed through both native promoter-driven expression in Arabidopsis and through transient expression experiments in tobacco leaves . Additionally, TIP2-2 has been observed in small vesicular structures, suggesting potential roles in membrane trafficking or vesicular transport processes .

How is TIP2-2 expression regulated spatially and developmentally in Arabidopsis?

TIP2-2 shows a precise tissue-specific expression pattern that appears to be developmentally regulated. Using promoter-GFP fusion studies, researchers have determined that TIP2-2 is highly expressed in the cortex of the elongation zone of the main root and in mature lateral roots . Interestingly, TIP2-2 expression is absent in lateral root primordia and early developing lateral roots, suggesting that its function is restricted to maturing tissues rather than developing ones . TIP2-2 is also prominently expressed in Arabidopsis leaf epidermal pavement cells . This specific expression pattern indicates that TIP2-2 likely plays specialized roles in fully differentiated tissues rather than in actively dividing or newly forming organs.

What are the key structural features of TIP2-2 that contribute to its water transport function?

While the search results don't provide specific structural information about TIP2-2, aquaporins typically share common structural features that enable their function as water channels. As a member of the tonoplast intrinsic protein family, TIP2-2 likely contains six transmembrane domains connected by five loops, with both N- and C-termini facing the cytoplasm. The channel would contain the characteristic NPA (Asparagine-Proline-Alanine) motifs that form the water-selective pore. TIP2-2's ability to localize to both vacuolar and plasma membranes suggests it may contain specific targeting sequences or structural elements that allow this dual localization . These structural characteristics would be crucial for its function in facilitating water and solute transport across cellular membranes.

How does TIP2-2 contribute to ion transport and homeostasis?

TIP2-2 appears to play a role in ion homeostasis, particularly for sodium (Na⁺) and potassium (K⁺) ions, though its effects seem to depend on genetic background and expression level of other transporters. Studies have shown that overexpression of TIP2-2 alone didn't enhance sodium accumulation, but when combined with high expression of HKT1 (High-affinity K⁺ Transporter 1), it resulted in enhanced root Na⁺ content in the Col-0 ecotype . Additionally, increased shoot K⁺ accumulation was observed in TIP2-2 overexpression lines with high HKT1 expression, while root K⁺ levels remained unchanged . These findings suggest that TIP2-2 may enhance vacuolar storage of Na⁺ in roots while promoting vacuolar K⁺ retention in shoots, indicating a tissue-specific function in ion compartmentalization .

What methods are effective for studying TIP2-2 subcellular localization?

Researchers have effectively employed several complementary approaches to determine TIP2-2 subcellular localization:

  • Translational GFP Fusion with Native Promoter: Creating a translational fusion of AtTIP2;2 with GFP driven by the TIP2;2 native promoter allowed visualization of the protein's expression pattern and subcellular localization in planta . This approach preserves native expression levels and regulation.

  • Confocal Laser-Scanning Microscopy: High-resolution imaging of GFP-tagged TIP2-2 in various plant tissues enabled researchers to visualize its presence in different membrane compartments, including structures resembling the plasma membrane, vacuole, and small vesicles .

  • Transient Expression in Heterologous Systems: Transient expression of 35S::AtTIP2;2::GFP in tobacco-infiltrated leaves provided additional confirmation of the protein's capacity to localize to multiple membrane compartments .

  • Co-localization Studies: Though not explicitly mentioned for TIP2-2, co-localization with known membrane markers would be valuable for definitively identifying the exact membrane compartments where TIP2-2 resides.

These methodological approaches collectively provide robust evidence for TIP2-2's dual localization to both vacuolar and plasma membranes in plant cells.

What genetic approaches are useful for investigating TIP2-2 function?

Several genetic approaches have proven valuable for investigating TIP2-2 function:

  • T-DNA Insertion Mutants: Loss-of-function tip2;2 mutants have been instrumental in revealing TIP2-2's role in root development, showing enhanced lateral root elongation when the gene is disrupted .

  • Constitutive Overexpression Lines: Generating 35S promoter-driven TIP2-2 overexpression lines in different genetic backgrounds (Col-0 and C24) has helped reveal the effects of increased TIP2-2 levels on plant development and stress responses .

  • Combinatorial Genetic Approaches: Creating lines with altered expression of both TIP2-2 and other genes (such as HKT1) has revealed genetic interactions and functional relationships . For example, overexpressing TIP2-2 in plants with tissue-specific overexpression of HKT1 demonstrated their combined effect on lateral root development and ion accumulation.

  • Promoter-Reporter Fusions: Using the TIP2-2 promoter to drive expression of reporter genes like GFP has enabled detailed analysis of tissue-specific and developmental expression patterns .

These genetic tools provide complementary data about TIP2-2 function through both loss-of-function and gain-of-function approaches across different genetic backgrounds.

What analytical techniques can be used to measure TIP2-2-mediated water and solute transport?

While the search results don't directly specify analytical techniques for measuring TIP2-2-mediated transport, several established methods would be applicable:

  • Ion Content Analysis: Measurement of Na⁺ and K⁺ content in different tissues of wild-type, tip2;2 mutant, and TIP2-2 overexpression plants has been used to assess TIP2-2's impact on ion accumulation . This typically involves tissue digestion followed by atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS).

  • Osmotic Stress Assays: Similar to studies with other TIP family members, applying osmotic treatments to wild-type and genetically modified plants would reveal TIP2-2's contribution to osmotic adjustment .

  • Volumetric Measurements: Techniques similar to those used for other aquaporins, where volume changes of isolated organelles or protoplasts are measured under osmotic challenge, could reveal TIP2-2's water transport capacity .

  • Heterologous Expression Systems: Expression of TIP2-2 in systems like Xenopus oocytes or yeast cells would allow direct measurement of water and solute permeability using swelling assays or fluorescent indicators.

  • Pressure Probe Techniques: Cell pressure probe or root pressure probe measurements could evaluate TIP2-2's contribution to cellular water relations in intact tissues.

These methodologies would provide quantitative data on TIP2-2's transport properties and physiological significance.

How does TIP2-2 contribute to root development and architecture?

TIP2-2 plays a significant regulatory role in root development and architecture, particularly in lateral root development under both normal and salt stress conditions. Loss-of-function analysis through T-DNA mutants revealed that tip2;2 mutants exhibit enhanced lateral root elongation compared to wild-type plants . This suggests that TIP2-2 normally functions as a negative regulator of lateral root development. Consistent with this hypothesis, overexpression of TIP2-2 in plants already overexpressing HKT1 resulted in a further decrease in lateral root length, with the effect being most significant in the C24 genetic background .

Importantly, TIP2-2 shows a specific expression pattern in roots, being absent from lateral root primordia and early developing lateral roots but highly expressed in the cortex of the elongation zone of the main root and in mature lateral roots . This expression pattern suggests that TIP2-2's role is restricted to maturing tissues rather than actively developing ones, potentially affecting root architecture by regulating water and solute movement in fully differentiated root tissues rather than at the meristematic or early developmental stages.

What role does TIP2-2 play in salt stress responses?

TIP2-2 appears to function in salt stress responses, particularly in relation to ion homeostasis and root development. Under salt stress conditions, TIP2-2 contributes to the regulation of Na⁺ and K⁺ distribution and accumulation in different plant tissues. Specifically, TIP2-2 overexpression combined with high HKT1 expression resulted in enhanced root Na⁺ content in the Col-0 ecotype, suggesting that TIP2-2 may enhance vacuolar storage of Na⁺ in roots . This could be a mechanism for sequestering toxic Na⁺ ions away from the cytoplasm during salt stress.

Additionally, TIP2-2 overexpression led to increased shoot K⁺ accumulation in plants with high HKT1 expression, indicating a potential role in maintaining favorable K⁺/Na⁺ ratios during salt stress . The observation that TIP2-2 has different effects on ion accumulation depending on the organ suggests tissue-specific functions in salt stress adaptation .

TIP2-2 also affects root architecture under salt stress, with its overexpression in HKT1 overexpression lines resulting in decreased lateral root length . This morphological adaptation could be part of the plant's strategy to cope with saline conditions.

How does TIP2-2 interact with other transporters like HKT1?

TIP2-2 shows significant functional interactions with HKT1 (High-affinity K⁺ Transporter 1), suggesting coordinated roles in ion transport and stress responses. RNA sequencing data revealed enhanced expression of TIP2;2 in HKT1 overexpression lines in both Col-0 and C24 backgrounds compared to wild-type plants . This indicates that HKT1 might positively regulate TIP2-2 expression, establishing a potential regulatory relationship between these transporters.

The interaction between TIP2-2 and HKT1 also affects root development, as TIP2-2 overexpression in plants with tissue-specific overexpression of HKT1 caused a further decrease in lateral root length, particularly in the C24 genetic background . These findings indicate that the functional relationship between TIP2-2 and HKT1 influences both ion homeostasis and developmental processes, with effects that can vary depending on the genetic background.

What phenotypes are observed in TIP2-2 loss-of-function mutants?

TIP2-2 loss-of-function mutants display several distinct phenotypes that provide insights into the protein's physiological roles. The most prominent phenotype observed in tip2;2 T-DNA insertion mutants is enhanced lateral root elongation compared to wild-type plants . This suggests that TIP2-2 normally functions as a negative regulator of lateral root development, with its absence leading to increased lateral root growth.

The search results don't mention other phenotypes directly associated with TIP2-2 loss-of-function, but based on knowledge of other TIP family members, we can infer that additional effects might include altered osmotic adjustment capacity and water relations. For comparison, mutants lacking other TIP family members (TIP1;2 and TIP2;1) showed altered chloroplast and thylakoid volume changes upon osmotic treatment and in light conditions, as well as reduced rates of photosynthetic electron transport . While TIP2-2's role may differ given its distinct localization pattern, similar physiological impacts on cellular water relations would be expected.

It's worth noting that the absence of dramatic visible phenotypes under standard growth conditions (which seems to be the case based on the limited phenotypes reported) is common for aquaporin mutants due to functional redundancy within this large protein family.

How does constitutive overexpression of TIP2-2 affect plant development and stress responses?

The effects of TIP2-2 overexpression on plant development and stress responses appear to be context-dependent, varying based on genetic background and the expression levels of other transporters. When TIP2-2 was constitutively overexpressed using the 35S promoter in either Col-0 or C24 genetic backgrounds, no noticeable differences in root architecture were observed under either control or salt stress conditions compared to wild-type plants . This suggests that simply increasing TIP2-2 levels is not sufficient to alter development under these conditions.

In terms of stress responses, TIP2-2 overexpression affected ion accumulation patterns during salt stress, but only in conjunction with HKT1 overexpression. In the Col-0 background with high HKT1 expression, TIP2-2 overexpression resulted in enhanced root Na⁺ content and increased shoot K⁺ accumulation . This suggests that TIP2-2 contributes to ion homeostasis during salt stress by promoting differential ion accumulation in different plant organs.

What approaches can be used to generate recombinant TIP2-2 for structural and functional studies?

While the search results don't specifically detail methods for producing recombinant TIP2-2, several approaches can be inferred from standard techniques used for membrane proteins and from methods mentioned for related studies:

These approaches would provide purified recombinant TIP2-2 for structural studies (X-ray crystallography, cryo-EM) and functional characterization (transport assays, binding studies).

How might TIP2-2 contribute to intracellular vesicle trafficking and membrane dynamics?

TIP2-2's observed localization to small vesicular structures, in addition to the vacuolar and plasma membranes , suggests potential roles in vesicle trafficking and membrane dynamics that remain largely unexplored. Several hypotheses can be formulated based on current knowledge:

First, TIP2-2 might facilitate water movement into or out of vesicles during trafficking events, potentially affecting vesicle size, osmotic balance, or fusion kinetics. Aquaporins in trafficking vesicles could regulate vesicle swelling or shrinking in response to osmotic gradients encountered during movement through the cytoplasm.

Second, TIP2-2 could be actively trafficked between the tonoplast and plasma membrane via vesicular transport, explaining its dual localization. This suggests it might participate in dynamic membrane remodeling in response to environmental cues or developmental signals. The absence of TIP2-2 in developing lateral roots but its presence in mature roots hints at developmental regulation of its trafficking.

Third, TIP2-2 might function in specialized vesicles involved in vacuolar remodeling during stress responses. Salt stress induces vacuolar compartmentalization in many plants, and TIP2-2's role in enhancing Na⁺ accumulation when co-expressed with HKT1 could involve facilitating the formation or function of such compartments.

Future research using high-resolution live-cell imaging of fluorescently tagged TIP2-2 combined with vesicle trafficking inhibitors or markers for different vesicle types could elucidate these potential functions.

What is the relationship between TIP2-2 and other membrane proteins in regulating water and solute transport?

The functional interaction between TIP2-2 and HKT1 revealed in the research likely represents just one example of a complex network of interactions between TIP2-2 and other membrane proteins. Several aspects of these relationships warrant further investigation:

First, TIP2-2 may form regulatory networks with other ion transporters beyond HKT1. The enhanced expression of TIP2;2 in HKT1 overexpression lines suggests transcriptional co-regulation. Similar relationships might exist with other transporters involved in K⁺, Na⁺, or other ion homeostasis, such as NHX-type antiporters or other channels.

Second, TIP2-2 might interact physically with other membrane proteins to form functional complexes. Direct protein-protein interactions could modify transport properties, trafficking patterns, or stability of the involved proteins. Techniques like co-immunoprecipitation, split-ubiquitin yeast two-hybrid assays, or FRET/FLIM could identify such interactions.

Third, TIP2-2 could cooperate functionally with other aquaporins from different subfamilies (PIPs, NIPs, etc.) to create an integrated water transport network across different cellular compartments. The specific expression pattern of TIP2-2 in mature roots but not developing lateral roots suggests specialized coordination with other transporters active in these tissues.

Understanding these relationships would provide insights into how plants achieve precise regulation of water and solute transport across different membranes and cell types in response to environmental challenges.

What molecular mechanisms regulate TIP2-2 activity during abiotic stress responses?

The regulation of TIP2-2 during abiotic stress likely involves multiple layers of control that remain to be fully elucidated. Based on the available information and knowledge of other aquaporins, several regulatory mechanisms can be proposed:

  • Transcriptional Regulation: TIP2-2 expression appears to be enhanced in HKT1 overexpression lines , suggesting transcriptional regulation in response to altered ion transport status. This may extend to direct transcriptional responses to abiotic stresses like salt, drought, or cold.

  • Post-translational Modifications: Many aquaporins are regulated by phosphorylation, which can alter their gating properties or subcellular localization. TIP2-2 likely contains phosphorylation sites that respond to stress-activated kinases, potentially controlling its water transport activity or trafficking.

  • Trafficking Regulation: TIP2-2's dual localization to plasma membrane and tonoplast suggests dynamic trafficking processes that might be regulated during stress responses. This could involve selective internalization from one membrane or redirected trafficking to change the relative abundance at different cellular locations.

  • Gating Mechanisms: Aquaporin water transport activity can be regulated through conformational changes triggered by cytosolic pH, calcium levels, or direct mechanical stimuli - all of which might change during abiotic stress responses.

  • Protein-Protein Interactions: Interactions with other proteins, as suggested by the functional relationship with HKT1 , could modify TIP2-2 activity in response to changing environmental conditions.

Future research combining phosphoproteomic analysis, site-directed mutagenesis of regulatory residues, and real-time imaging of TIP2-2 trafficking during stress responses would help illuminate these regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.