Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 10 (B3GALT10)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant B3GALT10

Recombinant B3GALT10 is a full-length protein (1–345 amino acids) derived from Arabidopsis thaliana and expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
UniProt IDQ94A05
Gene NameB3GALT10 (synonyms: HPGT2, At4g32120, F10N7.70)
Molecular Weight~39 kDa (calculated)
Purity>90% by SDS-PAGE
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for long-term storage

The amino acid sequence (MESLPTTVSG...CSMA) includes conserved domains characteristic of glycosyltransferases .

Stability and Activity

  • Thermal Stability: Maintains activity after reconstitution at 4°C for ≤1 week .

  • Catalytic Requirements: Utilizes UDP-galactose as a donor substrate, similar to other GT-family-31 enzymes .

  • Inhibitors: Sensitivity to divalent cations not yet characterized.

Role in Glycosylation Pathways

B3GALT10 is hypothesized to catalyze β-1,3-galactose linkages in:

  • AGP Biosynthesis: Modifying hydroxyproline-rich glycoproteins critical for cell signaling .

  • N-Glycan Modification: Potential involvement in terminal glycosylation, akin to GALT1 .

Genetic Interactions

  • Co-Expressed Genes: Associates with other glycosyltransferases (e.g., GALT2, GALT3) in transcriptome datasets .

  • Knockout Phenotypes: Not yet reported, but AGP-deficient mutants exhibit developmental abnormalities .

Experimental Use Cases

  • Enzyme Assays: Used in vitro to test galactosyltransferase activity using UDP-galactose and synthetic glycopeptide acceptors .

  • Structural Biology: Crystallization trials to resolve catalytic mechanisms .

  • Plant Biotechnology: Engineering cell wall polysaccharides for improved biomass conversion .

Challenges and Future Directions

  • Functional Validation: Requires in vivo complementation assays to confirm substrate specificity .

  • Structural Data: High-resolution structures are needed to guide protein engineering .

  • Evolutionary Analysis: Cross-species comparisons with A. lyrata homologs could reveal adaptive roles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HPGT2; B3GALT10; At4g32120; F10N7.70; Hydroxyproline O-galactosyltransferase HPGT2; Beta-1,3-galactosyltransferase 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HPGT2
Target Protein Sequence
MESLPTTVSGKSDRRGRFSKSQNTSKPSLILAFFSCLAWLYVAGRLWQDAQYRAALNTVL KMNYDQRPKVLTVEDKLVVLGCKDLERRIVETEMELAQAKSQGYLKKQKSVSSSGKKMLA VIGVYTGFGSHLKRNKFRGSWMPRDDALKKLEERGVVIRFVIGRSANRGDSLDRKIDEEN RATKDFLILENHEEAQEELPKKVKFFYSAAVQNWDAEFYVKVDDNVDLDLEGMIALLESR RSQDGAYIGCMKSGDVITEEGSQWYEPEWWKFGDDKSYFRHATGSLVILSKNLAQYVNIN SGLLKTYAFDDTTIGSWMIGVQATYIDDNRLCCSSTRQEKVCSMA
Uniprot No.

Target Background

Function
This protein exhibits hydroxyproline O-galactosyltransferase activity, transferring galactose from UDP-galactose to hydroxyproline residues within arabinogalactan proteins (AGPs). It displays specificity for AGPs containing non-contiguous peptidyl hydroxyproline residues. Galactose addition to peptidyl hydroxyproline residues in AGP core proteins constitutes the initial committed step in arabinogalactan polysaccharide biosynthesis. AGP glycans play critical roles in both plant vegetative and reproductive growth.
Database Links

KEGG: ath:AT4G32120

STRING: 3702.AT4G32120.1

UniGene: At.25086

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in roots, rosette leaves, cauline leaves, stems, flowers and siliques.

Q&A

What is Arabidopsis thaliana beta-1,3-galactosyltransferase 10 and what is its primary function?

Beta-1,3-galactosyltransferases in Arabidopsis, including B3GALT10, belong to a family of enzymes responsible for transferring galactose residues to various glycan substrates. Based on studies of related galactosyltransferases such as GALT1, these enzymes catalyze the transfer of β1,3-linked galactose residues to N-glycan acceptor substrates. The specific function of B3GALT10 can be inferred from research on GALT1, which demonstrates that galactosyltransferases play crucial roles in glycoprotein modification and are essential for the biosynthesis of complex structures such as Lewis a epitopes in Arabidopsis tissues . Galactosyltransferases like B3GALT10 are integral to proper glycan assembly and modification, with significant implications for plant development and physiological processes.

How does B3GALT10 compare structurally with other characterized beta-1,3-galactosyltransferases in Arabidopsis?

When examining the structural characteristics of B3GALT10 compared to other characterized beta-1,3-galactosyltransferases such as GALT1, researchers should focus on conserved domains, active sites, and membrane topology. GALT1, a functionally characterized β1,3-galactosyltransferase in Arabidopsis, has been shown through recombinant protein expression to effectively transfer galactose residues to N-glycan substrates . The structural comparison would involve analysis of catalytic domains, transmembrane regions, and potential regulatory domains. Sequence alignment and structural modeling approaches would reveal the degree of similarity between B3GALT10 and other family members, providing insights into potential functional conservation or specialization among these enzymes.

What glycan substrates does B3GALT10 preferentially modify?

While specific substrate preferences for B3GALT10 require experimental characterization, insights can be drawn from studies on related galactosyltransferases. For instance, recombinant GALT1 produced in insect cells demonstrated activity on N-glycan acceptor substrates, particularly with dabsylated GnGn-peptide substrates. When incubated with UDP-galactose as a donor substrate, GALT1 generated mono- and di-galactosylated reaction products that could be detected by MALDI-TOF mass spectrometry, showing mass increases of 162 and 324 D, respectively . This methodological approach provides a framework for characterizing the substrate specificity of B3GALT10, which would likely include similar N-glycan structures but may exhibit distinct preferences based on its specific biological role.

What is the subcellular localization of B3GALT10 and how can it be visualized?

B3GALT10, like other glycosyltransferases involved in glycan biosynthesis, is likely localized to the endomembrane system. Drawing parallels from related enzymes, visualization approaches similar to those used for other Arabidopsis glycosyltransferases would be applicable. For instance, studies with ALG10, an α1,2-glucosyltransferase in Arabidopsis, utilized ALG10-GFP fusion proteins expressed in Nicotiana benthamiana leaf epidermal cells to reveal a reticular distribution pattern characteristic of endoplasmic reticulum localization . A similar experimental approach using fluorescent protein tagging would be appropriate for B3GALT10 localization studies. Researchers should construct a B3GALT10-GFP fusion protein under a suitable promoter, express it in plant cells, and visualize using confocal microscopy. Co-localization studies with known compartment markers would further confirm its precise subcellular compartment.

What is the tissue-specific expression pattern of B3GALT10 during Arabidopsis development?

To determine the tissue-specific expression pattern of B3GALT10, researchers should employ a combination of approaches similar to those used for other glycosyltransferases and transcription factors in Arabidopsis. For instance, the expression patterns of TGA9 and TGA10 transcription factors were characterized throughout early anther primordia, revealing resolution to specific layers during meiosis of pollen mother cells . For B3GALT10, researchers could generate transgenic plants expressing reporter genes (such as GUS or fluorescent proteins) under the control of the native B3GALT10 promoter. Alternatively, quantitative RT-PCR analysis of RNA extracted from different tissues at various developmental stages would provide a comprehensive expression profile. This expression data could then be correlated with glycan profiles in corresponding tissues to establish functional relationships.

How does environmental stress affect B3GALT10 expression and activity?

Environmental stresses likely influence B3GALT10 expression and activity, as demonstrated by studies on other glycosylation-related enzymes in Arabidopsis. For example, inactivation of ALG10, an α1,2-glucosyltransferase, resulted in increased salt sensitivity and activation of the unfolded protein response . To investigate how stress affects B3GALT10, researchers should expose Arabidopsis plants to various stress conditions (drought, salt, temperature extremes, pathogen infection) and analyze changes in B3GALT10 expression using quantitative RT-PCR. In parallel, enzymatic activity assays using isolated microsomes or recombinant protein would determine if stress conditions alter catalytic efficiency. Glycoproteomic analyses comparing stress-exposed and control plants would reveal changes in B3GALT10-dependent glycan structures, providing insights into the enzyme's role in stress adaptation.

What is the optimal protocol for producing recombinant B3GALT10 with maximum enzymatic activity?

For optimal production of recombinant B3GALT10 with preserved enzymatic activity, researchers should consider the expression system used for related galactosyltransferases. Based on successful approaches with GALT1, insect cell expression systems appear suitable for producing functional plant glycosyltransferases . A comprehensive protocol would include:

  • Gene cloning: Amplify the B3GALT10 coding sequence from Arabidopsis cDNA, excluding the transmembrane domain if present.

  • Vector construction: Insert the sequence into a baculovirus expression vector with an appropriate purification tag.

  • Insect cell transfection: Use Sf9 or High Five insect cells for protein expression.

  • Culture conditions: Optimize temperature, time, and media composition.

  • Protein purification: Employ affinity chromatography followed by size exclusion to obtain pure protein.

  • Activity preservation: Include appropriate glycerol percentage and stabilizing agents in storage buffer.

To verify enzymatic activity, assay the purified recombinant protein with appropriate donor (UDP-galactose) and acceptor substrates, analyzing reaction products using mass spectrometry as demonstrated in the GALT1 study .

How can researchers effectively analyze B3GALT10 enzyme kinetics and substrate specificity?

To effectively analyze B3GALT10 enzyme kinetics and substrate specificity, researchers should employ methodologies similar to those used for characterized galactosyltransferases. A comprehensive approach would include:

  • Substrate preparation: Synthesize or isolate a range of potential glycan acceptor substrates.

  • Reaction conditions optimization: Determine optimal pH, temperature, and cofactor requirements.

  • Kinetic analysis: Measure initial reaction velocities at varying substrate concentrations to determine Km and Vmax values.

  • Product analysis: Utilize MALDI-TOF mass spectrometry to identify reaction products, as demonstrated for GALT1 where mono- and di-galactosylated products were detected with mass increases of 162 and 324 D, respectively .

For analyzing substrate specificity, researchers should test B3GALT10 activity against a panel of glycan structures to establish preferential acceptor profiles. Competition assays with multiple substrates would further refine understanding of substrate preferences. The experimental data should be presented in a comprehensive table format:

SubstrateKm (μM)Vmax (μmol/min/mg)Catalytic Efficiency (Vmax/Km)
N-glycan A---
N-glycan B---
O-glycan C---

This systematic approach would provide fundamental insights into B3GALT10 biochemical properties and substrate preferences.

What methods are effective for generating and validating B3GALT10 knockout or knockdown lines in Arabidopsis?

For generating and validating B3GALT10 knockout or knockdown lines in Arabidopsis, researchers can employ several complementary approaches based on successful strategies used for related genes:

  • T-DNA insertion mutants: Screen Arabidopsis T-DNA insertion collections (SALK, GABI, SAIL) for lines with insertions in B3GALT10. This approach was successfully used for ALG10, where a homozygous T-DNA insertion mutant (alg10-1) was characterized .

  • CRISPR/Cas9 gene editing: Design guide RNAs targeting B3GALT10 coding regions to generate precise deletions or frameshift mutations.

  • RNA interference (RNAi): Develop constructs expressing B3GALT10-specific hairpin RNAs for post-transcriptional gene silencing.

For validation of these knockout/knockdown lines, researchers should conduct multiple levels of analysis:

  • Molecular validation: Confirm gene disruption through PCR genotyping and RT-PCR to verify absence of transcript.

  • Biochemical validation: Analyze glycan profiles using mass spectrometry to detect specific alterations in β1,3-galactosylated structures.

  • Enzymatic validation: Prepare microsomes from mutant plants and assay for reduced β1,3-galactosyltransferase activity.

  • Phenotypic analysis: Thoroughly characterize plant growth, development, and stress responses, as altered leaf size and stress sensitivity were observed in ALG10-deficient plants .

This multi-faceted validation approach ensures reliable mutant lines for subsequent functional studies.

What phenotypes are associated with B3GALT10 deficiency in Arabidopsis?

The phenotypic consequences of B3GALT10 deficiency would likely include developmental and physiological alterations, drawing parallels from studies of other glycosyltransferases in Arabidopsis. While specific B3GALT10 phenotypes need direct experimental characterization, insights can be gained from related enzymes. For instance, ALG10-deficient plants displayed altered leaf size when grown in soil, increased salt sensitivity, and activation of the unfolded protein response . Similarly, plants lacking functional TGA9 and TGA10 transcription factors showed defects in male gametogenesis .

To comprehensively assess B3GALT10-deficient phenotypes, researchers should analyze:

  • Developmental parameters: Germination rates, growth kinetics, leaf morphology, root architecture, flowering time, and reproductive structures.

  • Subcellular structures: Endomembrane system organization using transmission electron microscopy.

  • Stress responses: Performance under abiotic stresses (drought, salt, temperature) and biotic challenges.

  • Glycan profiles: Alterations in N-glycan structures using mass spectrometry.

  • Protein folding and secretion: Evidence of endoplasmic reticulum stress or unfolded protein response activation.

These comprehensive phenotypic analyses would establish the biological significance of B3GALT10 and its glycan products in plant development and environmental responses.

How does B3GALT10 function integrate with other glycosyltransferases in the glycan biosynthesis pathway?

B3GALT10 likely functions within a coordinated network of glycosyltransferases that sequentially modify glycan structures. To understand its integration with other enzymes, researchers should investigate:

  • Temporal sequencing: Determine if B3GALT10 activity precedes or follows other glycan modifications, similar to how GALT1 functions in Lewis a structure formation prior to fucosylation .

  • Spatial organization: Examine colocalization with other glycosyltransferases within the endomembrane system.

  • Substrate competition or synergy: Assess how mutations in related glycosyltransferases affect B3GALT10 activity and substrate availability.

  • Glycan profiling: Compare glycan structures in wild-type plants versus single and combined glycosyltransferase mutants to establish pathway relationships.

A systems biology approach, incorporating glycomics with transcriptomics data of multiple glycosyltransferases under various conditions, would provide insights into the coordinated regulation of glycan biosynthesis. This integrated understanding is essential for comprehending glycan structural diversity and its biological significance in plant systems.

What are the effects of overexpressing B3GALT10 in Arabidopsis or heterologous plant systems?

Overexpression of B3GALT10 in Arabidopsis or heterologous plants would likely alter glycan profiles and potentially affect development and stress responses. Drawing from studies of related enzymes, overexpression of GALT1 in Arabidopsis increased Lewis a epitope levels in planta , suggesting that B3GALT10 overexpression might similarly enhance specific β1,3-galactosylated structures.

To systematically investigate B3GALT10 overexpression effects, researchers should:

  • Generate transgenic lines expressing B3GALT10 under constitutive (35S) and tissue-specific promoters.

  • Quantify transcript and protein levels to confirm overexpression.

  • Analyze glycan profiles using mass spectrometry to identify altered glycan structures.

  • Assess developmental phenotypes throughout the plant life cycle.

  • Evaluate responses to environmental stresses to determine if enhanced β1,3-galactosylation affects stress tolerance.

  • Examine protein secretion efficiency and cell wall composition.

This comprehensive analysis would provide insights into the consequences of elevated B3GALT10 activity and the biological significance of its glycan products in plant physiology and development.

How can structural biology approaches be used to understand B3GALT10 substrate recognition and catalytic mechanism?

Structural biology approaches offer powerful tools for elucidating B3GALT10 substrate recognition and catalytic mechanisms. Researchers should pursue a multi-faceted structural analysis strategy:

  • Homology modeling: Generate preliminary structural models based on crystallized galactosyltransferases from plants or other organisms.

  • X-ray crystallography: Crystallize purified recombinant B3GALT10, potentially in complex with substrates or substrate analogs to capture different catalytic states.

  • Cryo-electron microscopy: For challenging crystallization cases, cryo-EM might resolve protein structure, particularly if B3GALT10 forms complexes with other proteins.

  • Site-directed mutagenesis: Target predicted catalytic residues and substrate binding sites to validate structural models through activity assays.

  • Molecular dynamics simulations: Model substrate binding and catalytic events to understand conformational changes during catalysis.

  • Nuclear magnetic resonance (NMR): Probe protein-ligand interactions and dynamic aspects of enzyme function.

These approaches would reveal the structural basis for B3GALT10's specificity and catalytic efficiency, informing rational enzyme engineering efforts and deepening understanding of glycan biosynthesis mechanisms in plants.

What approaches can identify proteins that interact with B3GALT10 in the glycosylation machinery?

Identifying proteins that interact with B3GALT10 requires complementary approaches that capture both stable and transient interactions within the glycosylation machinery. Researchers should implement:

  • Yeast two-hybrid screening: Similar to how TGA9 and TGA10 interactions with ROXY proteins were detected , this approach can identify direct protein-protein interactions.

  • Co-immunoprecipitation coupled with mass spectrometry: Isolate B3GALT10 complexes from plant tissues using specific antibodies or epitope tags.

  • Bimolecular fluorescence complementation (BiFC): Visualize protein interactions in living plant cells by expressing B3GALT10 and candidate interactors fused to complementary fragments of fluorescent proteins.

  • Proximity-based labeling: Express B3GALT10 fused to enzymes like BioID or APEX2 that biotinylate nearby proteins, allowing subsequent purification and identification.

  • Split-ubiquitin membrane yeast two-hybrid: Particularly suitable for identifying interactions between membrane proteins in the endomembrane system.

  • Genetic interaction screens: Analyze phenotypes of double mutants combining B3GALT10 deficiency with mutations in other glycosylation-related genes.

These approaches would reveal B3GALT10's functional partners, potentially uncovering glycosylation complexes or regulatory interactions that coordinate glycan assembly in plant cells.

How can glycoproteomic approaches identify specific targets of B3GALT10 in different plant tissues and developmental stages?

Advanced glycoproteomic approaches can systematically identify specific targets of B3GALT10 across plant tissues and developmental stages. Researchers should implement a comprehensive workflow:

  • Comparative glycoproteomics: Compare glycoprotein profiles between wild-type and B3GALT10-deficient plants using hydrazide chemistry or lectin affinity enrichment followed by mass spectrometry.

  • Site-specific glycan analysis: Identify the exact glycosylation sites modified by B3GALT10 using electron-transfer dissociation (ETD) or electron-capture dissociation (ECD) mass spectrometry.

  • Developmental time course: Collect samples across developmental stages to track temporal changes in B3GALT10-dependent glycosylation.

  • Tissue-specific profiling: Analyze glycoproteomes from different organs and specialized tissues to map spatial distribution of B3GALT10 targets.

  • Pulse-chase labeling: Use metabolic labeling with stable isotopes to track newly synthesized glycoproteins modified by B3GALT10.

  • Targeted glycopeptide monitoring: Develop selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) assays for sensitive quantification of specific B3GALT10-modified glycopeptides.

This glycoproteomic workflow would generate a comprehensive map of B3GALT10 glycoprotein targets, revealing the enzyme's biological role across tissues and developmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.