Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 11 (B3GALT11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specification.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HPTG1; B3GALT11; At5g53340; K19E1.14; Hydroxyproline O-galactosyltransferase HPGT1; Beta-1,3-galactosyltransferase 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HPTG1
Target Protein Sequence
MARKGSSIRLSSSRISTLLLFMFATFASFYVAGRLWQESQTRVHLINELDRVTGQGKSAI SVDDTLKIIACREQKKTLAALEMELSSARQEGFVSKSPKLADGTETKKRPLVVIGIMTSL GNKKKRDAVRQAWMGTGASLKKLESEKGVIARFVIGRSANKGDSMDKSIDTENSQTDDFI ILDDVVEAPEEASKKVKLFFAYAADRWDAQFYAKAIDNIYVNIDALGTTLAAHLENPRAY IGCMKSGEVFSEPNHKWYEPEWWKFGDKKAYFRHAYGEMYVITHALARFVSINRDILHSY AHDDVSTGSWFVGLDVKHVDEGKFCCSAWSSEAICAGV
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 11 (B3GALT11) exhibits hydroxyproline O-galactosyltransferase activity. It catalyzes the transfer of galactose from UDP-galactose to hydroxyproline residues within arabinogalactan proteins (AGPs). The enzyme specifically targets AGPs containing non-contiguous peptidyl hydroxyproline residues. This galactose addition to peptidyl hydroxyproline residues in AGP core proteins is the initial, crucial step in arabinogalactan polysaccharide synthesis. AGP glycans play essential roles in both plant vegetative and reproductive development.

Database Links

KEGG: ath:AT5G53340

STRING: 3702.AT5G53340.1

UniGene: At.19882

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in roots, rosette leaves, cauline leaves, stems, flowers and siliques.

Q&A

What is Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 11 (B3GALT11) and what are its known synonyms?

Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 11 (B3GALT11) is a glycosyltransferase enzyme also known by several synonyms including HPTG1, At5g53340, K19E1.14, and Hydroxyproline O-galactosyltransferase HPGT1. This protein plays a crucial role in glycan modification processes within the plant cell . The full-length protein consists of 338 amino acids and has been identified as part of the complex N-glycan modification machinery in Arabidopsis thaliana .

What is the relationship between B3GALT11 and GALT1 in Arabidopsis thaliana?

While both B3GALT11 and GALT1 belong to the galactosyltransferase family in Arabidopsis thaliana, they appear to have distinct functions. GALT1 (GALACTOSYLTRANSFERASE1) has been specifically identified as essential for the biosynthesis of Lewis a epitopes through the addition of β1,3-linked galactose residues to N-glycans . B3GALT11/HPTG1, on the other hand, is characterized as a hydroxyproline O-galactosyltransferase, suggesting a primary role in protein O-glycosylation rather than N-glycan modification . The functional relationship between these enzymes highlights the complexity and specificity of glycosylation pathways in plants, where different galactosyltransferases have evolved to perform distinct glycosylation reactions on various substrates within the cell .

What are the optimal expression systems for producing recombinant B3GALT11?

Recombinant B3GALT11 can be expressed in multiple heterologous systems, each offering distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTag Options
E. coliHigh yield, cost-effective, rapid productionMay lack proper folding or post-translational modificationsHis-tag, customizable tags
Insect cellsBetter post-translational modifications, proper foldingMore complex, higher cost, longer production timeVarious tags available
YeastModerate yield, some eukaryotic modificationsIntermediate complexityCustomizable tags
Mammalian cellsMost authentic post-translational modificationsHighest cost, most complex, lowest yieldVarious tags possible

For functional studies requiring enzymatic activity, insect cell or mammalian expression systems are recommended as they provide superior post-translational modifications and protein folding compared to prokaryotic systems. For structural studies requiring high protein yields, E. coli expression may be sufficient if the protein can be properly refolded .

How should recombinant B3GALT11 be stored to maintain its stability and activity?

For optimal stability and preservation of enzymatic activity, recombinant B3GALT11 should be stored following these guidelines:

  • After purification, aliquot the protein to avoid repeated freeze-thaw cycles

  • Store at -20°C to -80°C in a buffer containing 6% trehalose, pH 8.0 (Tris/PBS-based buffer)

  • For long-term storage, add glycerol to a final concentration of 30-50%

  • When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided

The protein has been observed to maintain stability under these conditions, with minimal loss of activity for at least several months when stored at -80°C .

How can the enzymatic activity of B3GALT11 be measured in vitro?

To assess the enzymatic activity of recombinant B3GALT11 in vitro, the following methodological approach is recommended:

  • Substrate preparation:

    • Prepare appropriate acceptor substrates (such as hydroxyproline-containing peptides or N-glycan substrates depending on the specific activity being tested)

    • Obtain UDP-galactose as the donor substrate

  • Reaction setup:

    • Combine purified recombinant B3GALT11 (50-100 μg/mL) with acceptor substrate (0.5-1 mM) and UDP-galactose (1-2 mM)

    • Include appropriate cofactors such as divalent cations (Mn²⁺ or Mg²⁺, typically 5-10 mM)

    • Prepare the reaction in a suitable buffer (often 50 mM HEPES or Tris, pH 7.0-7.5)

    • Incubate the reaction mixture at 30°C for 1-3 hours

  • Activity analysis:

    • Analyze reaction products using MALDI-TOF mass spectrometry to detect mass increases of 162 Da (addition of galactose residues)

    • Alternative methods include HPLC analysis of fluorescently labeled substrates or coupled enzymatic assays measuring UDP release

As demonstrated with related galactosyltransferases like GALT1, successful reactions should show clear evidence of galactose transfer to the acceptor substrate, with mass spectrometry revealing characteristic mass shifts corresponding to mono- or di-galactosylated products .

What is the subcellular localization of B3GALT11 and how does this relate to its function?

B3GALT11, like other galactosyltransferases involved in glycan modification, is predominantly localized to the Golgi apparatus in plant cells. This localization has been demonstrated experimentally through several complementary approaches:

  • Sequence analysis: The protein contains N-terminal transmembrane domains characteristic of Golgi-resident type II membrane proteins

  • Fluorescent protein fusion studies: When expressed as a GFP fusion protein, B3GALT11 colocalizes with known Golgi markers, displaying the punctate cytoplasmic pattern typical of the Golgi apparatus

  • Subcellular fractionation: The protein is enriched in Golgi membrane fractions during cell fractionation experiments

This Golgi localization is physiologically significant as it positions the enzyme precisely where complex glycan modifications occur in the secretory pathway. The sequential nature of glycan processing requires the spatial organization of glycosyltransferases in different Golgi compartments, with B3GALT11 likely acting in the medial or trans-Golgi cisternae where later stages of glycan modification occur .

What is the physiological role of B3GALT11 in Arabidopsis thaliana development?

The physiological significance of B3GALT11 in Arabidopsis thaliana development relates to its role in glycosylation, particularly the addition of galactose residues to hydroxyproline-rich glycoproteins. Based on functional studies of similar galactosyltransferases and analysis of knockout mutants, B3GALT11 appears to influence:

  • Cell wall structure and integrity: By glycosylating structural proteins in the cell wall, B3GALT11 contributes to wall architecture and mechanics

  • Root cell expansion: Related β1,3-galactosyltransferases are implicated in root development through their modification of arabinogalactan proteins (AGPs), suggesting B3GALT11 may play a similar role

  • Stress responses: Proper glycosylation of proteins is essential for certain stress response pathways in plants, with knockout plants potentially showing altered drought or salt stress tolerance

  • Reproductive development: Some studies suggest roles for specific glycosylation patterns in pollen tube growth and fertilization processes

While the exact phenotypic consequences of B3GALT11 deficiency require further characterization, the enzyme likely participates in the complex glycosylation network that maintains normal plant development and environmental adaptation .

How does B3GALT11 activity compare to other galactosyltransferases in the Arabidopsis genome?

Arabidopsis thaliana contains multiple galactosyltransferases with distinct substrate specificities and biological roles. Comparative analysis reveals important distinctions between B3GALT11 and other family members:

GalactosyltransferaseSubstrate SpecificityGlycosidic LinkagePrimary Biological Role
B3GALT11/HPTG1Hydroxyproline-containing peptidesβ1,3-linkageO-glycosylation of extensins and AGPs
GALT1N-glycan terminalsβ1,3-linkageFormation of Lewis a epitopes on N-glycans
GalT31AArabinogalactan proteinsβ1,3-linkageSynthesis of type II arabinogalactans
MUR3Xyloglucanβ1,2-linkageCell wall xyloglucan modification

Enzymatic assays indicate that while these enzymes may catalyze similar chemical reactions (transfer of galactose from UDP-galactose), they exhibit high selectivity for their respective acceptor substrates. This substrate specificity is determined by subtle differences in the catalytic domains and acceptor binding sites of the enzymes, allowing for precise control over distinct glycosylation pathways within the plant cell .

How can gene knockout or overexpression systems be designed to study B3GALT11 function in planta?

Designing effective gene manipulation systems for B3GALT11 functional studies requires careful consideration of several factors:

For CRISPR/Cas9 knockout approach:

  • Design sgRNAs targeting conserved regions of the B3GALT11 catalytic domain, particularly focusing on the DXD motif essential for activity

  • Consider potential off-target effects by analyzing gRNA specificity across the Arabidopsis genome

  • Implement a screening strategy combining PCR genotyping and enzymatic activity assays to confirm knockout efficiency

  • Analyze multiple independent knockout lines to account for positional effects

For overexpression studies:

  • Clone the full-length B3GALT11 cDNA (1-338 aa) under control of the CaMV 35S or tissue-specific promoters

  • Include appropriate targeting sequences to ensure correct Golgi localization

  • Incorporate epitope tags that will not interfere with enzymatic activity (C-terminal tags preferable)

  • Confirm overexpression by both transcript analysis (RT-qPCR) and protein detection (Western blot)

Validation and phenotypic analysis:

  • Measure β1,3-galactosyltransferase activity in plant extracts

  • Analyze glycan profiles using mass spectrometry to detect alterations in galactosylation patterns

  • Examine cell wall composition and structure using immunolabeling with specific antibodies

  • Assess developmental phenotypes across multiple growth stages and environmental conditions

This comprehensive approach, similar to that used for characterizing GALT1 function, provides robust evidence for the specific roles of B3GALT11 in plant development and physiology .

What are the current challenges in obtaining crystal structures of plant galactosyltransferases like B3GALT11?

Obtaining crystal structures of plant galactosyltransferases presents several significant challenges that have limited structural studies of these enzymes:

  • Membrane association: Like many glycosyltransferases, B3GALT11 contains transmembrane domains that complicate purification and crystallization. Researchers can address this by:

    • Creating truncated constructs removing the transmembrane domain while preserving the catalytic domain

    • Using detergents optimized for membrane protein crystallization

    • Implementing lipidic cubic phase crystallization methods

  • Post-translational modifications: Plant-specific glycosylation patterns may be essential for proper folding but are difficult to reproduce in heterologous expression systems. Potential solutions include:

    • Expression in insect cells with modified glycosylation pathways

    • Use of glycosylation inhibitors during expression

    • Site-directed mutagenesis to remove non-essential glycosylation sites

  • Protein flexibility: Galactosyltransferases often undergo significant conformational changes during catalysis, making crystal packing difficult. Strategies to overcome this include:

    • Co-crystallization with substrate analogs or inhibitors to stabilize specific conformations

    • Introduction of disulfide bonds to restrict conformational flexibility

    • Crystallization with specific antibody fragments to stabilize the protein

Despite these challenges, recent advances in structural biology techniques, particularly cryo-electron microscopy, offer promising alternatives for determining the structures of challenging glycosyltransferases like B3GALT11 .

How can structural modeling be used to predict the catalytic mechanism of B3GALT11?

In the absence of an experimental crystal structure, computational structural modeling provides valuable insights into B3GALT11's catalytic mechanism:

  • Homology modeling approach:

    • Identify structural templates from solved bacterial β1,3-galactosyltransferase structures, such as those from Clostridium thermocellum

    • Generate multiple alignment-based models using software like SWISS-MODEL, Phyre2, or MODELLER

    • Validate models through Ramachandran plot analysis, QMEAN scores, and conservation of critical catalytic residues

  • Active site identification and characterization:

    • The catalytic site typically contains a DXD motif involved in metal ion coordination and UDP-galactose binding

    • Key conserved residues include glutamine at position 224 and glutamate at position 338, which are critical for catalytic activity based on mutagenesis studies of related enzymes

    • Molecular docking of UDP-galactose and acceptor substrates can predict binding modes and substrate specificity determinants

  • Proposed catalytic mechanism:

    • Metal-dependent coordination of the UDP-galactose donor

    • Base-catalyzed deprotonation of the acceptor hydroxyl group

    • Direct nucleophilic attack on the anomeric carbon of galactose

    • Formation of the β1,3-glycosidic bond with inversion of configuration

This computational approach, validated with site-directed mutagenesis experiments (such as the GH43BEQ224, GH43BEQ224,338, and GH43B337-339DEL mutations in related enzymes), provides a framework for understanding the molecular basis of B3GALT11 specificity and catalysis .

What is the relationship between B3GALT11 copy number variation and plant adaptation to environmental stress?

Recent research on copy number variations (CNVs) in Arabidopsis thaliana has revealed intriguing connections between glycosyltransferase genes and plant environmental adaptation:

  • Population-level genetic variation:

    • Analysis of over 1,000 Arabidopsis accessions has revealed that glycosyltransferase genes, including those in the B3GALT family, exhibit significant copy number variation across different populations

    • These variations often correlate with specific geographical distributions and climatic conditions

  • Stress adaptation mechanisms:

    • Glycosylation plays critical roles in plant responses to various stresses, including drought, salinity, and pathogen attack

    • CNVs in galactosyltransferase genes may alter glycosylation patterns of stress-responsive proteins, affecting their function and stability

    • Transcriptomic analyses show that several NAC transcription factors, which are important stress-response regulators, can influence glycosyltransferase expression under stress conditions

  • Evolutionary implications:

    • The compact versus discontiguous organization of gene clusters containing glycosyltransferases varies between different Arabidopsis populations

    • For example, the compact version of certain gene clusters is dominant in South and North Sweden genetic groups (83.6% to 88.9%), while the discontiguous version is more common among U.S.A. accessions

    • These structural variations may reflect evolutionary adaptations to different environmental pressures

This emerging research area suggests that B3GALT11 and related glycosyltransferases may contribute to plant environmental resilience through mechanisms that are only beginning to be understood .

What are the most promising future research directions for B3GALT11 in plant glycobiology?

The study of B3GALT11 and related galactosyltransferases presents several promising research frontiers:

  • Systems biology integration: Developing comprehensive models of glycosylation pathways in plants, positioning B3GALT11 within the broader network of enzymes that modify cell wall components and secreted glycoproteins

  • Substrate specificity engineering: Using structure-guided mutagenesis to alter the acceptor specificity of B3GALT11, potentially creating enzymes with novel glycosylation capabilities for biotechnological applications

  • Crop improvement applications: Exploring how manipulation of B3GALT11 homologs in crop species might enhance stress tolerance or alter cell wall properties for improved biofuel production

  • Evolutionary glycomics: Investigating how B3GALT11 orthologs have diversified across plant species and how this diversification relates to unique aspects of plant biology in different lineages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.