Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 12 (B3GALT12)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 12 (B3GALT12) is a glycosyltransferase enzyme that is involved in the synthesis of complex carbohydrates in plants . Glycosyltransferases are enzymes that catalyze the transfer of monosaccharide moieties from activated nucleotide sugars to specific acceptor molecules, forming glycosidic bonds . These enzymes are crucial for the biosynthesis of a wide array of glycans, including those found in cell walls and glycoproteins .

Identification and Bioinformatics Analysis

B3GALT12 belongs to the glycosyltransferase family 31 (GT31) in the Carbohydrate-Active enZYmes (CAZy) database . Bioinformatic analysis has identified a group of Arabidopsis thaliana beta-(1,3)-galactosyltransferases, suggesting their role in synthesizing beta-(1,3)-Gal linkages . Microarray data indicates that members of this family are expressed in all tissues, making them likely candidates for assembling arabinogalactan-proteins (AGPs) .

Structure and Function

B3GALT12, as a member of the GT31 family, contains domains and motifs typical of biochemically characterized beta-(1,3)-GTs from mammalian systems . One member, At1g77810, was selected for further analysis including location studies that confirmed its presence in the Golgi and preliminary enzyme substrate specificity studies that demonstrated beta-(1,3)-GalT activity .

Expression and Localization

Expression studies using reverse transcription-polymerase chain reaction (RT-PCR) have demonstrated that all 10 AtGATL genes are transcribed, albeit to varying degrees, in Arabidopsis tissues . Subcellular localization studies of several GATL proteins using yellow fluorescent protein tagging provide evidence supporting the Golgi localization of these proteins .

Table 1: Expression of AtGATL Genes in Arabidopsis Tissues

GeneExpression LevelTissue
AtGATL1HighVascular tissue
AtGATL2ModerateStem
AtGATL3LowLeaves
AtGATL4ConfinedPollen grains
AtGATL5HighHypocotyl

Table 2: Glycome Profiling of Cell Wall Fractions from AtGATL Mutants

MutantGalA ContentXylose ContentPectins AffectedHemicelluloses Affected
atgatl3ReducedIncreasedYesYes
atgatl6ReducedIncreasedYesYes
atgatl9ReducedNo ChangeYesNo

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
B3GALT12; At2g26100; T19L18.9; Probable beta-1,3-galactosyltransferase 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT12
Target Protein Sequence
MPLFSHRFTTASSSSPASPSYYNKPSSKTHKPNSSSSSYTSSRIHVAIIFFSLVSVFIGV AGTIFALSSTGPASVYRCGGSKDTSRVVSASRKLGGDGGNNGVVVERRKLLGFVGIQTGF DSGDRRTALRSTWFPSDPDSLLRLEQATGLAFRFVIGKSKDAKKMAELEKEIKEYRDFVL LDTEEEYIRLPYKTLAFFKAAFKLFEADYYVKADDDIYLRPDRLATLLANERLHSQTYIG CMKKGPVITDPKLKWYEKQGNLIGNEYFLHAYGPIYVLSAEIVASLAAARNGSLRMFNNE DVTIGSWMLAMDVHHEDNRALCDPHCSPKSIAVWDIPKCSGLCDPESRLKELHKTDMCSK SPTLPPDDIDQ
Uniprot No.

Target Background

Function
Beta-1,3-galactosyltransferase; catalyzes the transfer of galactose from UDP-galactose to substrates possessing a terminal glycosyl residue.
Database Links

KEGG: ath:AT2G26100

STRING: 3702.AT2G26100.1

UniGene: At.43077

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 12 (B3GALT12) and what is its genomic location?

B3GALT12 is a putative glycosyltransferase from Arabidopsis thaliana classified in glycosyltransferase family GT31. It is encoded by the gene At2g26100 (also known as T19L18.9) and its protein is identified by UniProt accession number Q66GS2. The protein contains a conserved galactosyltransferase sequence domain (pfam 01762) that is characteristic of enzymes that catalyze the transfer of galactose from UDP-galactose to acceptor substrates .

How does B3GALT12 relate to other galactosyltransferases in Arabidopsis?

B3GALT12 is one of six Arabidopsis proteins that show significant sequence similarity to mammalian B3GALTs (23-31% identity and 45-55% similarity). All six proteins are annotated as members of glycosyltransferase family GT31 in the CAZy database. In Arabidopsis, GALT1 has been functionally characterized as a β1,3-galactosyltransferase essential for the biosynthesis of Lewis a structures on N-glycans, suggesting that B3GALT12 might perform similar or related functions in specific tissues or developmental stages .

What are the optimal storage conditions for recombinant B3GALT12 protein?

Recombinant B3GALT12 should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conservation at -80°C is recommended. It is important to avoid repeated freeze-thaw cycles as they can compromise protein activity. For short-term use (up to one week), working aliquots can be stored at 4°C. The protein stability can be further maintained by adding protease inhibitors to the storage buffer and minimizing exposure to oxidizing conditions .

How can I assess the enzymatic activity of recombinant B3GALT12 in vitro?

Based on protocols established for related galactosyltransferases like GALT1, you can assess B3GALT12 activity using:

  • MALDI-TOF MS analysis: Incubate purified B3GALT12 with appropriate acceptor substrates (e.g., GnGn-peptide) and UDP-galactose as donor. Analyze reaction products by mass spectrometry to detect mass increases of 162 Da per added galactose residue.

  • Radiochemical assay: Use UDP-[³H]galactose as donor substrate and measure incorporation of radioactive galactose into acceptor substrates.

  • Colorimetric/fluorometric assays: Couple the release of UDP during galactose transfer to NADH production, which can be monitored spectrophotometrically .

What expression systems are recommended for producing functional recombinant B3GALT12?

For functional expression of B3GALT12, consider the following systems:

Expression SystemAdvantagesLimitationsYieldPost-translational Modifications
Insect cells (Sf9, High Five)Proper folding, post-translational modificationsHigher cost, longer production timeModerate to highSimilar to plant modifications
Yeast (P. pastoris)Cost-effective, high yieldPotential hyperglycosylationHighMay differ from plant modifications
E. coliRapid, cost-effectiveLacks glycosylation machinery, inclusion body formationVariableLimited, requires refolding
Plant expression systems (N. benthamiana)Native-like modificationsVariable expressionLow to moderateMost similar to native

The choice of expression tags (His, GST, MBP) should be carefully considered as they may affect protein folding and activity. For enzymes like B3GALT12, insect cell expression has been successful for related galactosyltransferases .

How can proximity labeling techniques be adapted to study B3GALT12 interactors in Arabidopsis?

TurboID (TbID) and miniTurbo (mTb) proximity labeling systems can be effectively adapted to identify B3GALT12 interacting partners in vivo. To implement this approach:

  • Generate fusion constructs of B3GALT12 with TbID or mTb.

  • Express these constructs in Arabidopsis using tissue-specific or inducible promoters.

  • Apply biotin treatments (optimal concentration: 20-50 μM) for labeling.

  • For most Arabidopsis tissues, simple submergence in biotin solution is sufficient, though some tissues may benefit from vacuum infiltration.

  • Incubate for 10-60 minutes depending on the required sensitivity (longer times for mass spectrometry detection).

  • Isolate biotinylated proteins using streptavidin beads and identify them by mass spectrometry.

TbID generally shows higher activity than mTb but may produce more background labeling from endogenous biotin. Consider using appropriate controls and performing experiments at normal plant growth temperatures, as these systems may not be suitable for cold stress experiments .

What approaches can be used to investigate the substrate specificity of B3GALT12 compared to other Arabidopsis galactosyltransferases?

To characterize B3GALT12 substrate specificity:

  • Comparative enzymatic assays: Test B3GALT12 activity against a panel of potential substrates (different N-glycans, glycoproteins, or synthetic oligosaccharides) in parallel with other characterized galactosyltransferases like GALT1.

  • Structural modeling and mutagenesis: Use homology modeling based on known galactosyltransferase structures to identify potential substrate-binding residues. Create point mutations to test their effects on activity and specificity.

  • In vivo glycan profiling: Generate B3GALT12 knockout/overexpression lines and analyze changes in glycan profiles using techniques like MALDI-TOF MS or liquid chromatography coupled with mass spectrometry.

  • Glycan microarrays: Use glycan arrays to systematically screen for B3GALT12 binding preferences across hundreds of potential substrates simultaneously .

What is the functional relationship between B3GALT12 and Lewis a epitope biosynthesis in Arabidopsis?

While GALT1 has been established as essential for Lewis a epitope biosynthesis in Arabidopsis, the specific role of B3GALT12 requires further investigation. To explore this relationship:

  • Gene knockout studies: Generate CRISPR/Cas9-mediated B3GALT12 knockout lines and analyze changes in Lewis a epitope levels using immunoblotting with Lewis a-specific antibodies.

  • Complementation assays: Test whether B3GALT12 can restore Lewis a synthesis in GALT1-deficient plants or cell lines.

  • Expression correlation analysis: Examine whether B3GALT12 expression correlates with Lewis a epitope levels in different tissues or developmental stages.

  • In vitro sequential glycosylation: Test whether B3GALT12 reaction products can serve as substrates for α1,4-fucosyltransferase to generate Lewis a structures, similar to the established pathway for GALT1 .

How should I design experiments to investigate B3GALT12 function in Arabidopsis?

When designing experiments to study B3GALT12 function:

  • Use the Experimental Design Assistant (EDA) to plan your experiments, which can:

    • Suggest appropriate statistical analysis methods

    • Perform power calculations to determine sample size

    • Generate randomization sequences for unbiased experiments

    • Facilitate sharing experimental plans with collaborators

  • Include appropriate controls:

    • Wild-type Arabidopsis (Col-0 ecotype)

    • Known galactosyltransferase mutants (e.g., GALT1 knockout)

    • Empty vector controls for overexpression studies

    • Inactive enzyme variants (catalytic site mutants)

  • Consider tissue-specific expression patterns:

    • Analyze B3GALT12 expression across tissues using public transcriptome data

    • Target analyses to tissues with highest expression levels

    • Use tissue-specific promoters for targeted complementation studies

  • Account for potential redundancy among the six similar B3GALTs in Arabidopsis by generating multiple gene knockouts or using inducible amiRNA approaches .

What technological platforms are most suitable for characterizing glycan modifications mediated by B3GALT12?

For comprehensive characterization of B3GALT12-mediated glycan modifications:

TechnologyApplicationAdvantagesLimitations
MALDI-TOF MSGlycan profilingHigh throughput, sensitiveLimited quantification
LC-MS/MSDetailed glycan structureComprehensive structural informationComplex data analysis
HPAEC-PADMonosaccharide compositionQuantitative, robustLimited structural information
Glycan arraySubstrate specificityHigh throughput, systematicIn vitro conditions may not reflect in vivo
ImmunoblottingSpecific epitope detectionSimple, targetedLimited to available antibodies
Cryo-EM/X-ray crystallographyProtein structureAtomic resolutionChallenging for membrane proteins

Combining multiple approaches provides the most comprehensive characterization of B3GALT12 function and specificity .

How can high-quality Arabidopsis genome resources be leveraged in B3GALT12 research?

The availability of high-quality Arabidopsis genome assemblies, such as the Col-XJTU assembly with Oxford Nanopore Technology, offers several advantages for B3GALT12 research:

  • Precise genomic context analysis: Examine the chromosomal environment of B3GALT12 (At2g26100) to identify potential regulatory elements, including promoter regions and enhancers.

  • Improved genome editing: Design more precise CRISPR/Cas9 guide RNAs with reduced off-target effects by leveraging the high-accuracy genome sequence.

  • Transcriptional regulation insights: Analyze epigenetic marks and chromatin states in the B3GALT12 locus across different tissues and developmental stages using data mapped to the high-quality reference.

  • Evolutionary studies: Compare B3GALT12 with related genes in Arabidopsis and other plant species to infer evolutionary relationships and potential functional divergence .

What are common pitfalls in galactosyltransferase activity assays and how can they be addressed?

When conducting galactosyltransferase activity assays for B3GALT12, researchers should be aware of these common issues:

  • Low enzymatic activity:

    • Optimize buffer conditions (pH, metal ions, detergents)

    • Ensure protein is properly folded

    • Verify substrate quality and concentration

    • Include positive controls (e.g., commercial galactosyltransferases)

  • High background in proximity labeling experiments:

    • Use mTb instead of TbID when background is problematic

    • Optimize biotin concentration (20-50 μM recommended)

    • Reduce labeling time to minimize non-specific biotinylation

    • Include appropriate negative controls (e.g., BirA* with minimal activity)

  • Interference from endogenous plant glycosyltransferases:

    • Use in vitro systems with purified components

    • Include specific inhibitors of competing pathways

    • Use genetic backgrounds lacking related enzymes

  • Glycan heterogeneity in analysis:

    • Use glycosidase treatments to simplify mixtures

    • Employ high-resolution separation techniques

    • Consider synthetic defined substrates for controlled experiments

How can contradictory results in B3GALT12 functional studies be reconciled?

When faced with contradictory results regarding B3GALT12 function:

  • Examine methodological differences:

    • Expression systems used (prokaryotic vs. eukaryotic)

    • Protein tags and their positions

    • Assay conditions (buffer composition, temperature, pH)

    • Substrate sources and purity

  • Consider biological context:

    • Tissue-specific effects and expression patterns

    • Developmental stage differences

    • Redundancy with other galactosyltransferases

    • Potential moonlighting functions

  • Validate with multiple approaches:

    • Combine in vitro and in vivo studies

    • Use both gain-of-function and loss-of-function approaches

    • Apply orthogonal analytical techniques

    • Collaborate with labs using different methodologies

  • Examine post-translational regulation:

    • Phosphorylation status

    • Protein-protein interactions

    • Subcellular localization

    • Protein stability and turnover

What are the key considerations for reproducibility in B3GALT12 research?

To ensure reproducible research outcomes when studying B3GALT12:

  • Standardize experimental conditions:

    • Maintain consistent growth conditions for Arabidopsis (light, temperature, humidity)

    • Use standardized plant developmental stages

    • Document exact composition of growth media and buffers

    • Establish SOPs for protein purification and activity assays

  • Ensure genetic material consistency:

    • Verify gene sequences in expression constructs

    • Confirm genotypes of transgenic/mutant lines

    • Use the same Arabidopsis ecotype (preferably Col-0)

    • Monitor for potential genetic drift in long-term cultures

  • Apply rigorous statistical approaches:

    • Determine appropriate sample sizes through power calculations

    • Use randomization and blinding where applicable

    • Apply appropriate statistical tests based on data distribution

    • Report all experimental attempts, including negative results

  • Document detailed methods:

    • Record detailed protocols including lot numbers of reagents

    • Share materials and detailed protocols with collaborators

    • Consider pre-registration of experimental designs

    • Deposit raw data in appropriate repositories

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.