Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 13 (B3GALT13)

Shipped with Ice Packs
In Stock

Description

Functional Insights

B3GALT13 is implicated in the biosynthesis of type II arabinogalactan (AG) chains on AGPs, which are essential for plant cell wall structure, signaling, and development . While its exact substrates remain under investigation, studies on homologous enzymes like GALT1 (At1g26810) provide mechanistic insights:

  • Catalytic Activity: β1,3-GalTs transfer galactose to terminal N-acetylglucosamine (GlcNAc) or galactose residues on glycoproteins .

  • Subcellular Localization: Like GALT1, B3GALT13 is likely Golgi-resident, as AGP glycosylation occurs in the secretory pathway .

Comparative Analysis of Arabidopsis β1,3-Galactosyltransferases

ProteinGeneFunctionSubstrate SpecificityKey Reference
B3GALT13At3g14960AGP glycan synthesis (putative)AGP core β1,3-galactan chains
GALT1At1g26810Lewis a epitope biosynthesisN-glycans

Research Applications

  • Glycobiology Studies: Probe AGP biosynthesis mechanisms or engineer plant glycans for industrial applications .

  • Enzyme Characterization: Study structure-function relationships via mutagenesis of catalytic domains .

  • Biotechnological Tool: Produce plant-style glycoproteins in heterologous systems .

Challenges and Future Directions

  • Functional Validation: Direct evidence of B3GALT13’s role in AGP glycosylation is needed, as current data rely on bioinformatic homology .

  • Structural Biology: Cryo-EM or X-ray crystallography could resolve its 3D structure to guide enzyme engineering .

  • Crosstalk with Other GTs: AGP synthesis involves multiple glycosyltransferases; B3GALT13’s interplay with β1,6-GalTs or arabinosyltransferases remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
B3GALT13; At3g14960; K15M2.10; Probable beta-1,3-galactosyltransferase 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT13
Target Protein Sequence
MSSSPKLFHARPSFFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRSCLTNLPP KTVKIVWDVAGNSIVNGEVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEE STGLAIRFIIGKTKDEAKMVELRSEVAMYDDFILLDIEEEYSKLPYKTLAFFKAAYALYD SEFYVKADDDIYLRPDRLSLLLAKERGHSQTYLGCMKKGPVFTDPKLKWYEPLADLLGKE YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENLHTLCEPEC SPYSIAVWDIPKCSGLCNPEKRMLELHMLESCSKSPTLPSDDE
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Probable beta-1,3-galactosyltransferase 13 (B3GALT13) is a beta-1,3-galactosyltransferase that catalyzes the transfer of galactose from UDP-galactose to substrates possessing a terminal glycosyl residue.
Database Links

KEGG: ath:AT3G14960

UniGene: At.6657

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the functional significance of beta-1,3-galactosyltransferase in Arabidopsis thaliana?

Beta-1,3-galactosyltransferases in Arabidopsis are primarily involved in the biosynthesis of Lewis a (Le a) epitopes by transferring β1,3-linked galactose residues to N-glycan acceptor substrates. This enzymatic action is a critical step in N-glycan processing, as the addition of these galactose residues serves as a prerequisite for subsequent fucosylation by α1,4-fucosyltransferase to generate Lewis a structures . The GALT1 gene (At1g26810) has been identified as encoding a functional β1,3-galactosyltransferase that is both sufficient and essential for this process .

Functional studies have demonstrated that overexpression of GALT1 increases Lewis a epitope levels in planta, while knockout or selective downregulation via RNA interference abolishes the synthesis of these structures . This confirms the indispensable role of β1,3-galactosyltransferase in complex glycan synthesis pathways within plant systems.

How can researchers identify and classify beta-1,3-galactosyltransferases in the Arabidopsis genome?

Researchers can identify potential β1,3-galactosyltransferases in Arabidopsis through sequence similarity analysis with known mammalian B3GALTs. In previous studies, six Arabidopsis proteins with significant amino acid sequence similarity (23-31% identity and 45-55% similarity) to mammalian B3GALTs were identified . These proteins contain a conserved galactosyltransferase sequence domain (pfam 01762) and are annotated as members of glycosyltransferase family GT31 in the CAZy database .

For classification, phylogenetic analysis can be performed using the 20 Arabidopsis proteins containing the galactosyltransferase domain together with mammalian GALTs. The six initially identified proteins cluster together in a distinct subfamily (subfamily 1), sharing 40-73% identity (59-84% similarity) with each other . All members of this subfamily contain B3GALT motifs as described by Hennet (2002) .

What expression systems are effective for producing recombinant beta-1,3-galactosyltransferase?

Insect cell expression systems have been successfully used to produce functional recombinant GALT1 protein. When purified GALT1 from this system was incubated with a glycopeptide acceptor substrate (dabsylated GnGn-peptide) and UDP-galactose as a donor substrate, the enzyme demonstrated galactosyltransferase activity . Analysis by MALDI-TOF MS revealed the formation of monogalactosylated (m/z = 2223) and digalactosylated (m/z = 2385) reaction products, confirming that the recombinant protein retained its functional capacity to act on N-glycans .

For in planta studies, transgenic Arabidopsis plants expressing GALT1 under the control of the 35S promoter have been generated, allowing for the examination of phenotypic effects of GALT1 overexpression . Similarly, heterologous expression of murine β1,3-galactosyltransferase 1 (Mm-B3GALT1) in Arabidopsis has been demonstrated to increase Lewis a signal intensity .

What methodological approaches can be used to characterize the enzymatic activity of recombinant beta-1,3-galactosyltransferase?

Characterization of β1,3-galactosyltransferase enzymatic activity requires a multi-faceted approach:

  • Substrate specificity analysis: Incubate purified recombinant enzyme with various N-glycan acceptor substrates (such as dabsylated GnGn-peptide) and UDP-galactose as donor substrate. Monitor reaction products using MALDI-TOF MS to detect mass increases corresponding to galactose additions (162 Da per galactose residue) .

  • Sequential enzymatic reactions: Treat the reaction products from the galactosyltransferase assay with α1,4-fucosyltransferase to confirm the formation of Lewis a structures, demonstrating the biological relevance of the galactosylation .

  • Kinetic analysis: Determine enzyme kinetics by varying substrate concentrations and measuring initial reaction rates to calculate Km and Vmax values for both donor and acceptor substrates.

  • pH and temperature optima: Assess enzymatic activity across different pH values and temperatures to establish optimal reaction conditions.

  • Cofactor requirements: Investigate the dependence on divalent cations (Mg2+, Mn2+) and other potential cofactors for maximum activity.

How can gene knockout or knockdown strategies be employed to study beta-1,3-galactosyltransferase function?

To investigate β1,3-galactosyltransferase function through gene silencing approaches:

  • T-DNA insertion lines: Utilize available T-DNA insertion mutants for the target gene. Verify the insertion site by PCR and confirm the absence of functional mRNA by RT-PCR .

  • RNA interference (RNAi): Design RNAi constructs targeting specific regions of the GALT1 transcript. Transform Arabidopsis plants with these constructs under the control of a constitutive or inducible promoter .

  • CRISPR-Cas9 genome editing: Design guide RNAs targeting the coding sequence of the GALT1 gene and introduce them along with Cas9 into Arabidopsis to generate precise gene knockouts.

  • Verification of knockout efficiency: Assess the absence of Lewis a epitopes on endogenous glycoproteins using immunoblotting with specific antibodies (e.g., JIM84) .

  • Complementation studies: Reintroduce the wild-type gene under control of its native promoter into knockout lines to confirm that the observed phenotypes are specifically due to the absence of the target gene .

What transcriptomic approaches can reveal the regulation of beta-1,3-galactosyltransferase expression under different conditions?

To investigate transcriptional regulation of β1,3-galactosyltransferase genes:

  • Microarray analysis: Utilize cDNA microarrays to examine changes in expression patterns across thousands of genes simultaneously under various conditions, such as pathogen infection or treatment with signaling molecules .

  • RNA-Seq: Implement next-generation sequencing to quantify transcript abundance with greater sensitivity and dynamic range than microarrays, allowing for discovery of novel transcripts and splice variants.

  • TOAST analysis platform: Apply the TOAST (Test of Arabidopsis Space Transcriptome) tool for comparative analysis of transcriptomes across different experimental conditions, including integration with Gene Ontology (GO) databases to identify functional enrichment .

  • Time-course studies: Examine gene expression at multiple time points after treatment to capture transient changes and establish temporal regulation patterns .

  • Integration with metadata: Connect expression data with metadata using platforms like Qlik database to translate between various gene identifiers (TAIR AGI, Affymetrix microarray Probe IDs, RNAseq transcript IDs, Ensembl ID) .

How should researchers design experiments to distinguish the specific functions of B3GALT13 from other galactosyltransferases?

To differentiate the functions of B3GALT13 from other galactosyltransferases:

  • Comparative enzymatic assays: Perform side-by-side enzyme activity assays with purified recombinant proteins from multiple galactosyltransferase family members, analyzing substrate preferences and reaction kinetics to identify unique characteristics of B3GALT13.

  • Gene-specific silencing: Design highly specific RNAi constructs or CRISPR-Cas9 guide RNAs that target unique regions of the B3GALT13 sequence to avoid off-target effects on related family members .

  • Differential expression analysis: Compare expression patterns of different galactosyltransferase genes across tissues, developmental stages, and in response to various stresses to identify condition-specific roles .

  • Protein localization studies: Generate fluorescent protein fusions with B3GALT13 and other family members to determine their subcellular localization, which may provide insights into their specific functions .

  • Glycan profile analysis: Compare the N-glycan profiles of wild-type plants with those of single and multiple galactosyltransferase mutants to identify specific glycan structures dependent on each enzyme.

What are the critical considerations when analyzing contradictory data regarding beta-1,3-galactosyltransferase function?

When facing contradictory results in β1,3-galactosyltransferase research:

  • Genetic background effects: Verify that all experiments use identical or comparable Arabidopsis ecotypes, as genetic variation can influence glycosylation patterns and enzyme function.

  • Environmental variables: Standardize growth conditions (light, temperature, humidity) as these factors can affect gene expression and glycan synthesis pathways .

  • Developmental timing: Consider the developmental stage of plant tissues used, as glycan composition can vary significantly throughout development.

  • Assay sensitivity and specificity: Evaluate whether different detection methods (immunoblotting, mass spectrometry, etc.) have comparable sensitivity and specificity for the glycan structures being studied .

  • Redundancy among family members: Assess potential functional redundancy by analyzing double or triple mutants when single mutants show subtle or no phenotypes .

  • Cross-talk between signaling pathways: Investigate potential interactions between different signaling pathways that might influence galactosyltransferase expression and activity .

What analytical techniques are most effective for detecting and quantifying Lewis a epitopes in plant glycoproteins?

For detection and quantification of Lewis a epitopes:

  • Immunoblotting: Use Lewis a-specific antibodies (such as JIM84) to detect and semi-quantify these epitopes on glycoproteins separated by SDS-PAGE .

  • Mass spectrometry:

    • MALDI-TOF MS for rapid screening of glycan compositions

    • LC-MS/MS for detailed structural analysis and quantification of specific glycans

  • Lectin affinity chromatography: Enrich for Lewis a-containing glycoproteins using lectins with specificity for these structures.

  • Fluorescent labeling: Label glycans with fluorescent tags followed by HPLC or capillary electrophoresis for quantitative analysis.

  • Enzyme-linked lectin assay (ELLA): Adapt ELISA techniques using lewis a-specific lectins or antibodies for high-throughput quantification.

How can structural analysis techniques be applied to understand beta-1,3-galactosyltransferase catalytic mechanisms?

To investigate the catalytic mechanism of β1,3-galactosyltransferase:

  • Homology modeling: Build structural models based on crystal structures of related mammalian B3GALTs, focusing on the conserved galactosyltransferase domain (pfam 01762) .

  • Site-directed mutagenesis: Target conserved residues putatively involved in substrate binding and catalysis, as identified through sequence alignments with mammalian B3GALTs .

  • X-ray crystallography: Determine the three-dimensional structure of the purified recombinant protein, ideally in complex with substrates or substrate analogs.

  • Molecular dynamics simulations: Model the dynamic interactions between the enzyme, donor substrate (UDP-galactose), and acceptor substrate (N-glycan).

  • NMR spectroscopy: Investigate protein-substrate interactions and conformational changes during catalysis for smaller functional domains of the enzyme.

What bioinformatic resources are available for analyzing beta-1,3-galactosyltransferase genes across plant species?

Key bioinformatic resources for comparative analysis include:

ResourceApplication for B3GALT ResearchURL/Reference
CAZy DatabaseClassification within glycosyltransferase family GT31http://afmb.cnrs-mrs.fr/CAZY/
TAIRArabidopsis genome and annotation datahttps://www.arabidopsis.org
SUBA4Subcellular locale predictions
TOASTTranscriptome analysis platform
Ensemble BioMartCross-species gene identifier translation
PfamIdentification of conserved protein domains (pfam 01762)
Phylogenetic analysis toolsClassification within galactosyltransferase subfamilies

How can standardized protocols be developed for comparative studies of beta-1,3-galactosyltransferase function across different plant systems?

To establish standardized protocols for cross-species comparisons:

  • Common expression systems: Utilize consistent heterologous expression systems (e.g., insect cells) for producing recombinant enzymes from different plant species .

  • Standardized enzyme assays: Develop uniform reaction conditions and substrate panels for enzymatic characterization, enabling direct comparison of kinetic parameters.

  • Reference glycan standards: Establish a set of well-characterized N-glycan standards for benchmarking glycan analysis across laboratories.

  • Metadata annotation: Implement comprehensive metadata annotation standards for experimental conditions, as demonstrated in the TOAST analysis platform .

  • Bioinformatic pipelines: Develop standardized computational workflows for sequence analysis, structural prediction, and functional annotation of galactosyltransferases from diverse plant species.

What are the emerging approaches for studying the role of beta-1,3-galactosyltransferase in plant stress responses?

Emerging approaches for investigating β1,3-galactosyltransferase in stress response include:

  • Single-cell transcriptomics: Analyze cell type-specific expression patterns of galactosyltransferases under various stress conditions.

  • Spatial glycomics: Map the distribution of Lewis a epitopes in different tissues and cell types during stress responses using advanced imaging techniques.

  • Integration with ROS signaling pathways: Investigate connections between β1,3-galactosyltransferase function and reactive oxygen species (ROS) signaling networks activated during stress, as suggested by TOAST analysis of spaceflight experiments .

  • Metabolic flux analysis: Trace the flow of metabolites through the nucleotide sugar pathways that provide UDP-galactose for β1,3-galactosyltransferase activity under stress conditions.

  • Systems biology approaches: Integrate transcriptomic, proteomic, and glycomic data to build comprehensive models of glycosylation dynamics during stress responses .

How might advances in synthetic biology facilitate novel applications of recombinant beta-1,3-galactosyltransferase?

Synthetic biology approaches for β1,3-galactosyltransferase applications:

  • Enzyme engineering: Design modified enzymes with enhanced activity, altered substrate specificity, or optimized expression through rational design and directed evolution.

  • Glycan pathway reconstruction: Reconstruct complete Lewis a biosynthetic pathways in heterologous systems for the production of specific glycan structures.

  • Biosensor development: Create biosensors for monitoring UDP-galactose levels or galactosyltransferase activity in vivo, utilizing fluorescent proteins or other reporter systems.

  • Cell-free glycan synthesis: Develop cell-free systems combining purified enzymes for the controlled synthesis of defined glycan structures.

  • Orthogonal glycosylation pathways: Introduce novel, orthogonal glycosylation pathways into plants for the production of non-native glycan structures with potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.