Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 14 (B3GALT14)

Shipped with Ice Packs
In Stock

Description

Introduction to Glycosyltransferases in Arabidopsis thaliana

Glycosyltransferases are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. These enzymes are crucial in the biosynthesis of plant cell walls and various glycoconjugates. Arabidopsis thaliana, a model organism for plant biology, encodes numerous glycosyltransferases, including those in the GT14 family.

GT14 Family and Glucuronosyltransferases

The GT14 family in Arabidopsis thaliana includes enzymes like AtGlcAT14A, AtGlcAT14B, and AtGlcAT14C, which are glucuronosyltransferases. These enzymes add glucuronic acid residues to β-1,3- and β-1,6-linked galactans of arabinogalactan proteins (AGPs), which are important for plant cell development and interactions .

Table 1: GT14 Family Members and Their Activities

Enzyme NameActivitySubstrate Preference
AtGlcAT14AGlucuronosyltransferaseβ-1,3 and β-1,6-galactans
AtGlcAT14BGlucuronosyltransferaseβ-1,3 and β-1,6-galactans, prefers β-1,6-galactan
AtGlcAT14CGlucuronosyltransferaseβ-1,3 and β-1,6-galactans, prefers β-1,3-galactan

Role of Glucuronosyltransferases in Plant Development

Glucuronosyltransferases in the GT14 family play roles in cell elongation and plant development. For example, the knockout of AtGlcAT14A results in enhanced growth rates of seedling hypocotyls and roots, indicating its involvement in cell elongation processes .

Expression and Localization of GT14 Enzymes

These enzymes are expressed in various tissues, including roots and seeds. AtGlcAT14A and B are more highly expressed in the meristematic zone of roots, while AtGlcAT14C is more abundant in the root tip and guard cells .

Table 2: Tissue-Specific Expression of GT14 Enzymes

Enzyme NameTissue-Specific Expression
AtGlcAT14AMicropylar endosperm, suspensor, meristematic zone of roots
AtGlcAT14BSimilar to AtGlcAT14A, with high expression in meristematic zone
AtGlcAT14CGuard cells, pollen, root tip

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
B3GALT14; At1g53290; F12M16.19; Probable beta-1,3-galactosyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT14
Target Protein Sequence
MHSPRKLFHARSSLATRRSTALVVLTSLAIGIAGFTFGLAVILIPGLRLTGRNCLTNTPP KTVRVVWDVAGNSNGVVSGEKKRHKVMGFVGIQTGFGSAGRRRSLRKTWMPSDPEGLRRL EESTGLAIRFMIGKTKSEEKMAQLRREIAEYDDFVLLDIEEEYSKLPYKTLAFFKAAYAL YDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLSHLLG KEYFLHAYGPIYALSADVVASLVALKNNSFRMFNNEDVTIGAWMLAMNVNHENHHILCEP ECSPSSVAVWDIPKCSGLCNPEKRMLELHKQESCSKSPTLPSDDE
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 14 (B3GALT14) is a beta-1,3-galactosyltransferase that catalyzes the transfer of galactose from UDP-galactose to substrates possessing a terminal glycosyl residue.

Database Links

KEGG: ath:AT1G53290

STRING: 3702.AT1G53290.1

UniGene: At.44986

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is B3GALT14 and what is its functional role in Arabidopsis thaliana?

B3GALT14 (AT1g53290) is a probable beta-1,3-galactosyltransferase encoded by the B3GALT14 gene in Arabidopsis thaliana. It belongs to the family of glycosyltransferases that catalyze the transfer of galactose residues to various glycan acceptor substrates. B3GALT14 contains a conserved glycosyltransferase domain and is predicted to participate in the biosynthesis of complex glycans by adding β1,3-linked galactose residues to appropriate acceptor substrates .

While B3GALT14's specific role hasn't been fully characterized, research on related galactosyltransferases in Arabidopsis suggests it may be involved in N-glycan modification pathways. For instance, GALT1, another β1,3-galactosyltransferase in Arabidopsis, has been shown to be essential for the biosynthesis of Lewis a (Lea) epitopes on N-glycans . Based on sequence homology and structural similarities, B3GALT14 may have comparable or complementary functions in specific tissues or developmental stages.

Where is B3GALT14 localized in plant cells?

While the specific subcellular localization of B3GALT14 hasn't been directly reported in the available literature, we can make informed predictions based on related galactosyltransferases. Most plant glycosyltransferases involved in glycan modification are localized to the Golgi apparatus, which is the primary site for complex glycan biosynthesis .

Using transient expression systems with fluorescent protein tags (such as YFP or GFP), researchers have demonstrated that many glycosyltransferases from the GT14 family (to which B3GALT14 is related) localize to the Golgi apparatus . The presence of an N-terminal transmembrane domain in B3GALT14 suggests it is likely a type II membrane protein with its catalytic domain facing the Golgi lumen, consistent with the topology of other glycosyltransferases.

For experimental verification of B3GALT14 localization, researchers typically use:

  • Transient expression of fluorescently-tagged fusion proteins (B3GALT14-GFP/YFP)

  • Co-localization with known Golgi markers

  • Subcellular fractionation followed by western blotting

What is the expression pattern of B3GALT14 in different tissues and developmental stages?

Expression data for B3GALT14 indicates tissue-specific patterns, with varying expression levels across different developmental stages. Although comprehensive tissue-specific expression data for B3GALT14 is limited in the search results, research approaches to determine expression patterns typically include:

  • Quantitative RT-PCR analysis across different tissues

  • Promoter-reporter gene fusions (B3GALT14 promoter driving GUS or GFP)

  • RNA-seq data analysis from public databases

When studying glycosyltransferase expression patterns, researchers should consider that these enzymes often show developmental regulation and may be induced under specific stress conditions. For instance, other genes in Arabidopsis have shown altered expression under microgravity conditions , suggesting environmental factors may influence glycosyltransferase expression.

How can I express and purify recombinant B3GALT14 for functional studies?

Successful expression and purification of recombinant B3GALT14 can be achieved through several expression systems, each with advantages for different applications:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsPurification Tags
E. coliHigh yield, cost-effectiveMay lack post-translational modifications, protein may be insolubleHis-tag, GST-tag
Insect cellsBetter folding, post-translational modificationsMore expensive, longer production timeHis-tag, FLAG-tag
Plant-based transient expressionNative post-translational modificationsVariable yields, longer processHis-tag, YFP/GFP fusion

For functional B3GALT14, insect cell expression systems have proven effective for related galactosyltransferases . A recommended protocol includes:

  • Clone the B3GALT14 coding sequence into a baculovirus expression vector with an appropriate purification tag

  • Generate recombinant baculovirus and infect insect cells (Sf9 or High Five)

  • Harvest cells 48-72 hours post-infection

  • Lyse cells in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1% Triton X-100, and protease inhibitors

  • Purify using affinity chromatography based on the chosen tag

  • Verify protein purity by SDS-PAGE and western blotting

Alternatively, transient expression in Nicotiana benthamiana has been successfully used for other Arabidopsis glycosyltransferases . This approach involves:

  • Cloning B3GALT14 into a plant expression vector with C-terminal tag

  • Transforming Agrobacterium tumefaciens with the construct

  • Infiltrating N. benthamiana leaves

  • Harvesting tissue 3-5 days post-infiltration

  • Preparing microsomal fractions for enzymatic assays

What are the optimal conditions for assaying B3GALT14 enzymatic activity?

Based on studies with related galactosyltransferases, the following conditions are recommended for assaying B3GALT14 activity:

Standard Assay Conditions:

ParameterRecommended ConditionNotes
Buffer50 mM HEPES or MES (pH 6.5-7.0)pH should be optimized
Metal ions10-20 mM MnCl₂Essential cofactor for most GTs
Donor substrate1-2 mM UDP-galactoseRadioactive or fluorescently labeled UDP-Gal can be used for detection
Acceptor substrate0.1-1 mM glycan/glycopeptideVarious N-glycan structures can be tested
Temperature28-30°CLower than mammalian GTs
Incubation time1-2 hoursTime course may be necessary

For product analysis, several complementary approaches are recommended:

  • MALDI-TOF mass spectrometry to detect mass shifts (+162 Da per galactose)

  • HPLC separation of fluorescently labeled products

  • Specific antibodies against galactosylated structures (if available)

A critical consideration is the selection of appropriate acceptor substrates. For B3GALT14, testing synthetic acceptors such as galactose-nitrobenzodiazole (Gal-NBD), β-1,6-galactotetraose (β-1,6-Gal₄) and β-1,3-galactopentose (β-1,3-Gal₅) would be recommended, as these have been successful for related galactosyltransferases .

Generation of Knockout Lines:

  • CRISPR/Cas9 Approach:

    • Design sgRNAs targeting exonic regions of B3GALT14

    • Transform Arabidopsis using floral dip method

    • Screen transformants using appropriate selection markers

    • Confirm mutations by sequencing

    • Select homozygous knockout lines in the T2 or T3 generation

  • T-DNA Insertion Lines:

    • Obtain available T-DNA insertion lines from seed repositories

    • Verify insertion by PCR genotyping

    • Confirm knockout status by RT-PCR and/or western blotting

Generation of Overexpression Lines:

  • Clone the full-length B3GALT14 cDNA into a plant expression vector under a constitutive promoter (e.g., 35S)

  • Transform Arabidopsis using the floral dip method

  • Select transformants on appropriate selection media

  • Screen for single-insert lines (3:1 segregation in T2)

  • Obtain homozygous lines in T3

  • Validate overexpression by RT-qPCR and western blotting

Validation Methods:

Validation ApproachTechniqueOutput
GenotypicPCR genotyping, sequencingConfirmation of genetic modification
Transcript levelRT-qPCR, RNA-seqQuantification of B3GALT14 expression
Protein levelWestern blottingDetection of B3GALT14 protein
Enzymatic activityGalactosyltransferase assaysFunctional validation
Glycan profilingMALDI-TOF MS, HPLCAltered glycan structures

For proper validation, backrossing to wild-type plants may be necessary to eliminate additional mutations, particularly with CRISPR-generated lines .

How does B3GALT14 function compare to other characterized galactosyltransferases in Arabidopsis?

The Arabidopsis genome encodes multiple galactosyltransferases with distinct functions in glycan biosynthesis. GALT1 has been well-characterized as essential for Lewis a epitope formation on N-glycans , while members of the GT14 family have demonstrated β-glucuronosyltransferase activity .

Comparative Analysis of Arabidopsis Galactosyltransferases:

EnzymeGene IDPrimary FunctionSubstratesKnown Phenotypes
GALT1At1g26810Lewis a epitope formationN-glycansAbsence of Lewis a structures
AtGlcAT14AAT5G39990Glucuronic acid transferAGPsAGP composition alterations
AtGlcAT14BAT5G15050Glucuronic acid transferAGPsAGP composition alterations
AtGlcAT14EAT3G15350Glucuronic acid transferAGPsAGP composition alterations
B3GALT14AT1g53290Probable galactose transferNot fully characterizedNot fully characterized

To investigate potential functional redundancy or specialization between B3GALT14 and other galactosyltransferases, researchers should consider:

  • Phylogenetic analysis to identify closest homologs

  • Expression pattern comparisons to identify co-expressed genes

  • In vitro substrate specificity assays with recombinant enzymes

  • Generation of single and multiple knockout lines to identify genetic interactions

Based on phylogenetic analysis of the GT14 family in Arabidopsis, 11 genes form three distinct clades (A, B, and C) . Understanding where B3GALT14 fits within this family would provide insights into its potential function.

What are the potential roles of B3GALT14 in plant stress responses?

While direct evidence for B3GALT14's involvement in stress responses is limited, glycosylation modifications are known to play important roles in plant stress adaptation. Glycoproteins containing specific glycan structures can influence cell wall composition, protein stability, and signaling pathways involved in stress responses.

Research on Arabidopsis has identified unique molecular adaptations in response to environmental stresses such as microgravity , and genes involved in chromatin memory of heat stress like FORGETTER1 . To investigate B3GALT14's potential role in stress responses, researchers could:

  • Analyze B3GALT14 expression under various stress conditions (drought, salt, heat, cold)

  • Compare stress sensitivity of B3GALT14 knockout or overexpression lines

  • Examine glycan profile changes in stress-exposed plants

  • Investigate protein interactions between B3GALT14 and known stress response factors

A comprehensive experimental design to study B3GALT14's role in stress responses might include:

  • Transcriptomic analysis comparing wild-type and B3GALT14 mutants under stress conditions

  • Biochemical characterization of glycan modifications during stress adaptation

  • Subcellular localization studies during stress exposure

  • Complementation studies with B3GALT14 variants

How can I analyze the glycan structures produced by B3GALT14 activity?

Analysis of glycan structures modified by B3GALT14 requires specialized analytical techniques. Based on approaches used for similar studies, the following methodologies are recommended:

Analytical Methods for Glycan Structure Analysis:

MethodApplicationResolutionSample Requirements
MALDI-TOF MSMass determinationHighPurified glycans/glycopeptides
ESI-MS/MSStructural characterizationVery highPurified glycans/glycopeptides
HPLCSeparation of glycan isomersModerate-highFluorescently labeled glycans
Lectin binding assaysDetection of specific glycan epitopesLow-moderateCell/tissue extracts
Enzymatic sequencingLinkage determinationHighPurified glycans

For in vitro analysis, reaction products from B3GALT14 assays can be analyzed directly by MALDI-TOF MS to detect mass increases of 162 Da, representing the addition of galactose residues . For complex samples from plant tissues, a multi-step approach is necessary:

  • Extract and purify glycoproteins from plant tissues

  • Release N-glycans using PNGase A or other glycosidases

  • Label released glycans with fluorescent tags

  • Separate glycans by HPLC or capillary electrophoresis

  • Analyze structures by sequential exoglycosidase digestion and/or MS

For structural validation, treatment with specific exoglycosidases (β-galactosidases with different linkage specificities) can confirm the presence and linkage of galactose residues added by B3GALT14.

What phenotypes are associated with altered B3GALT14 expression in Arabidopsis?

While specific phenotypes associated with B3GALT14 mutation or overexpression have not been directly reported in the search results, related galactosyltransferase functions suggest potential phenotypic consequences. For instance, disruption of GALT1 abolished the synthesis of Lewis a epitopes in Arabidopsis .

To systematically characterize phenotypes associated with altered B3GALT14 expression, researchers should assess:

  • Growth and development parameters:

    • Germination rate

    • Root growth

    • Leaf development

    • Flowering time

    • Seed production

  • Cell wall composition and structure:

    • Monosaccharide composition analysis

    • Immunolabeling with glycan-specific antibodies

    • Cell wall ultrastructure by electron microscopy

  • Stress responses:

    • Tolerance to abiotic stresses (drought, salt, temperature)

    • Response to pathogen infection

    • Hormone sensitivity

  • Molecular phenotypes:

    • Altered glycan profiles

    • Changes in protein stability or localization

    • Transcriptional responses

Comparative phenotypic analysis between B3GALT14 mutants and other glycosyltransferase mutants could reveal functional relationships and provide insights into the biological significance of specific glycan modifications.

How can I investigate potential protein interactions and regulatory networks involving B3GALT14?

Understanding the protein interaction network and regulatory mechanisms of B3GALT14 is essential for elucidating its biological function. Several complementary approaches can be used:

Protein Interaction Methods:

  • Yeast two-hybrid screening:

    • Use B3GALT14 as bait to screen Arabidopsis cDNA libraries

    • Validate interactions by co-immunoprecipitation

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged B3GALT14 in Arabidopsis

    • Purify protein complexes and identify components by MS

    • Verify interactions with co-immunoprecipitation

  • Bimolecular fluorescence complementation (BiFC):

    • Fuse B3GALT14 and candidate interactors to split fluorescent protein fragments

    • Co-express in plant cells and visualize reconstituted fluorescence

Transcriptional Regulation:

  • Promoter analysis:

    • Identify conserved regulatory elements in the B3GALT14 promoter

    • Generate promoter-reporter constructs with deletions/mutations

    • Test activity in different tissues and conditions

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors binding to the B3GALT14 promoter

    • Perform ChIP-seq to map genome-wide binding sites

  • Transcriptome analysis:

    • Compare gene expression profiles between wild-type and B3GALT14 mutants

    • Identify co-regulated genes and potential regulatory pathways

Integration of these data with existing knowledge of glycosylation pathways and stress responses would provide a comprehensive understanding of B3GALT14's role in plant biology.

What are the key unanswered questions regarding B3GALT14 function?

Despite advances in glycobiology research, several critical questions about B3GALT14 remain unanswered:

  • What are the specific acceptor substrates and linkage specificity of B3GALT14?

  • How does B3GALT14 activity contribute to plant development and stress responses?

  • What is the three-dimensional structure of B3GALT14 and how does it determine substrate specificity?

  • Are there tissue-specific glycan structures dependent on B3GALT14 activity?

  • How is B3GALT14 expression and activity regulated under different environmental conditions?

What emerging technologies could advance our understanding of B3GALT14 function?

Recent technological advances offer new opportunities for investigating glycosyltransferase function:

  • CRISPR base editing technologies:

    • Generate specific amino acid substitutions to study structure-function relationships

    • Create conditional knockout systems for temporal control

  • Single-cell glycomics:

    • Analyze glycan profiles at cellular resolution

    • Identify cell-specific functions of B3GALT14

  • Cryo-EM and AlphaFold2 predictions:

    • Determine structural features of B3GALT14

    • Model enzyme-substrate interactions

  • Metabolic glycan labeling:

    • Track newly synthesized glycans in vivo

    • Visualize glycan dynamics during development and stress

  • Multi-omics integration:

    • Combine glycomics with transcriptomics, proteomics, and metabolomics

    • Develop systems biology models of glycan biosynthesis networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.