Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 16 (B3GALT16)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 16 (B3GALT16) is a protein found in the plant Arabidopsis thaliana. Enzymes in the glycosyltransferase family, such as B3GALT16, catalyze the transfer of monosaccharides to specific acceptor molecules, forming glycosidic bonds . These enzymes are vital for synthesizing diverse glycans, which play crucial roles in plant cell walls, signaling pathways, and various other biological processes .

Protein Structure

The structure of a protein is generally described by four levels of organization:

Gene Family

B3GALT16 belongs to a Galacturonosyltransferase-Like (GATL) gene family in Arabidopsis thaliana . This family is closely related to a group of 15 genes (Galacturonosyltransferase1 [GAUT1] to -15), one of which (GAUT1) has been shown to encode a functional galacturonosyltransferase .

Expression and Localization

Expression studies using reverse transcription-polymerase chain reaction show that all 10 AtGATL genes are transcribed, albeit to varying degrees, in Arabidopsis tissues . Most AtGATL genes are expressed strongly in vascular tissue in both the stem and hypocotyl . Subcellular localization studies of several GATL proteins using yellow fluorescent protein tagging provide evidence supporting the Golgi localization of these proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
GALT3; B3GALT16; At3g06440; F24P17.7; Hydroxyproline O-galactosyltransferase GALT3; Beta-1,3-galactosyltransferase 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GALT3
Target Protein Sequence
MKQFMSVVRFKFGFTSVRMRDWSVGVSIMVLTLIFIIRYEQSDHTHTVDDSSIEGESVHE PAKKPHFMTLEDLDYLFSNKSFFGEEEVSNGMLVWSRMRPFLERPDALPETAQGIEEATL AMKGLVLEINREKRAYSSGMVSKEIRRICPDFVTAFDKDLSGLSHVLLELPCGLIEDSSI TLVGIPDEHSSSFQIQLVGSGLSGETRRPIILRYNVNFSKPSIVQNTWTEKLGWGNEERC QYHGSLKNHLVDELPLCNKQTGRIISEKSSNDDATMELSLSNANFPFLKGSPFTAALWFG LEGFHMTINGRHETSFAYREKLEPWLVSAVKVSGGLKILSVLATRLPIPDDHASLIIEEK LKAPSLSGTRIELLVGVFSTGNNFKRRMALRRSWMQYEAVRSGKVAVRFLIGLHTNEKVN LEMWRESKAYGDIQFMPFVDYYGLLSLKTVALCILGTKVIPAKYIMKTDDDAFVRIDELL SSLEERPSSALLYGLISFDSSPDREQGSKWFIPKEEWPLDSYPPWAHGPGYIISHDIAKF VVKGHRQRDLGLFKLEDVAMGIWIQQFNQTIKRVKYINDKRFHNSDCKSNYILVHYQTPR LILCLWEKLQKENQSICCE
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 16 (B3GALT16) possesses hydroxyproline O-galactosyltransferase activity. It catalyzes the transfer of galactose from UDP-galactose to hydroxyproline residues within arabinogalactan proteins (AGPs). The enzyme exhibits specificity for AGPs containing non-contiguous peptidyl hydroxyproline residues and utilizes UDP-galactose exclusively as the sugar donor. Galactose addition to peptidyl hydroxyproline residues in AGP core proteins represents the initial, committed step in arabinogalactan polysaccharide biosynthesis. AGP glycans play crucial roles in both vegetative and reproductive plant development.

Database Links

KEGG: ath:AT3G06440

STRING: 3702.AT3G06440.1

UniGene: At.28708

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in juvenile leaves, stems, cauline leaves and siliques.

Q&A

What is the biochemical function of Beta-1,3-Galactosyltransferase 16 in Arabidopsis thaliana?

Beta-1,3-Galactosyltransferase 16 (B3GALT16) in Arabidopsis thaliana belongs to the GT31 family of glycosyltransferases and is predicted to catalyze the transfer of β1,3-linked galactose residues to various glycan substrates. This enzyme plays a potential role in complex N-glycan modification, although its specific function should be distinguished from the well-characterized GALT1, which is definitively involved in Lewis a epitope biosynthesis .

For experimental verification of galactosyltransferase activity, recombinant protein can be incubated with appropriate acceptor substrates (such as dabsylated GnGn-peptide) and UDP-galactose as a donor substrate. The reaction products can then be analyzed by MALDI-TOF MS to detect mass increases of 162 and 324 D, representing monogalactosylated and digalactosylated products, respectively .

How does B3GALT16 compare structurally and functionally with other galactosyltransferases in Arabidopsis?

Within the Arabidopsis genome, several galactosyltransferases have been identified and characterized, with distinct functional roles:

GalactosyltransferasePrimary FunctionSubstrate SpecificityCellular Localization
GALT1Lewis a epitope biosynthesis on N-glycansN-glycansGolgi apparatus
GALT2-6Synthesis of β1,3-galactan chains of arabinogalactan-proteins (AGPs)Arabinogalactan proteinsGolgi apparatus
GALT31ASynthesis of β1,3-galactan chains of AGPsArabinogalactan proteinsNot fully characterized
B3GALT16Not fully characterizedPredicted to modify N-glycansPredicted in Golgi apparatus

B3GALT16's amino acid sequence contains motifs typical of the GT31 family, although its specific catalytic properties require further experimental validation. Phylogenetic analysis places it in a distinct clade from GALT1, suggesting potential functional diversification .

What expression systems are most effective for producing recombinant B3GALT16 protein?

For functional characterization of B3GALT16, several expression systems have been employed with varying success:

For optimal purification and activity, consider these methodological factors:

  • Include 6% trehalose in storage buffer at pH 8.0 to maintain stability

  • Aliquot and store at -80°C to avoid repeated freeze-thaw cycles

  • When reconstituting lyophilized protein, use a final glycerol concentration of 20-50% for long-term storage

How can I design experiments to validate the galactosyltransferase activity of B3GALT16?

To experimentally validate B3GALT16 activity, follow this comprehensive workflow:

  • In vitro enzyme assays:

    • Purify recombinant B3GALT16 using affinity chromatography

    • Incubate with appropriate glycan acceptor substrates (e.g., dabsylated GnGn-peptide) and UDP-galactose donor

    • Analyze reaction products by MALDI-TOF MS to detect mass increases of 162 Da (single galactose addition)

    • Confirm product structure using additional methods such as linkage analysis

  • Genetic complementation:

    • Generate transgenic Arabidopsis plants lacking functional B3GALT16 using T-DNA insertion or CRISPR/Cas9

    • Introduce wild-type or mutant B3GALT16 constructs to test functional complementation

    • Assess rescue of phenotype or restoration of glycan structures

  • Subcellular localization:

    • Create B3GALT16-GFP fusion constructs for transient or stable expression

    • Use confocal laser scanning microscopy to determine localization (likely Golgi apparatus)

    • Confirm by co-localization with known Golgi markers

What phenotypes are associated with B3GALT16 knockout or overexpression in Arabidopsis?

Unlike some better-characterized galactosyltransferases, the specific phenotypes associated with B3GALT16 manipulation require further investigation. Based on research with related galactosyltransferases in Arabidopsis:

For knockout/knockdown studies:

  • Use T-DNA insertion lines or RNA interference (RNAi) to downregulate B3GALT16 expression

  • Generate CRISPR/Cas9-mediated knockout lines for complete gene inactivation

  • Screen for altered glycan profiles using mass spectrometry and specific antibodies

  • Evaluate growth parameters, stress responses, and cell wall properties

For overexpression studies:

  • Create 35S promoter-driven constructs for constitutive expression

  • Consider tissue-specific promoters for targeted expression

  • Analyze alterations in glycan profiles and potential phenotypic effects

  • Assess changes in stress tolerance, particularly to drought, as glycosylation alterations may affect water deficit responses

When designing transformation experiments, use established vectors like pCAMBIA1301 with appropriate selection markers. For Arabidopsis transformation, the floral dip method has proven effective, with transgenic seedlings selected on media containing antibiotics like hygromycin (30 μg/mL) .

How do environmental conditions affect B3GALT16 expression and function?

The regulation of galactosyltransferases in response to environmental conditions represents an important research area. While specific data on B3GALT16 regulation is limited, research on related glycosyltransferases provides insights into experimental approaches:

  • Stress conditions for testing:

    • Water deficit (controlled drought stress)

    • Temperature stress (both heat and cold)

    • Salt stress

    • Pathogen exposure

  • Expression analysis:

    • Quantify B3GALT16 transcript levels under various conditions using RT-qPCR

    • Use Arabidopsis Actin2 as an internal reference gene

    • Consider global transcriptome analysis (RNA-Seq) to identify co-regulated genes

  • Functional assays:

    • Compare wild-type and transgenic plants (overexpression or knockout) under stress conditions

    • Measure physiological parameters including relative water content, MDA and H₂O₂ levels, proline content, and antioxidant enzyme activities (SOD, POD)

    • Document survival rates following stress treatment and recovery periods

Preliminary research with other plant galactosyltransferases indicates that growth conditions can significantly influence experimental outcomes, with controlled environment growth chambers (16h day light, 19°C) producing more consistent results than greenhouse conditions .

How can I distinguish between the specific activities of different beta-1,3-galactosyltransferases in Arabidopsis?

Distinguishing between the activities of B3GALT16 and other galactosyltransferases requires sophisticated experimental approaches:

  • Substrate specificity profiling:

    • Test activity against a panel of defined substrates

    • Compare activity with various acceptors (N-glycans, O-glycans, AGPs)

    • Analyze reaction kinetics and substrate preferences

  • Structural biology approaches:

    • Perform homology modeling based on known galactosyltransferase structures

    • Identify key catalytic residues and substrate-binding sites

    • Design site-directed mutagenesis experiments to test functional predictions

  • Multi-omics integration:

    • Combine glycomics, transcriptomics, and proteomics data

    • Use correlation networks to identify specific roles and relationships

    • Apply computational approaches to predict functional relationships

When designing experiments involving multiple galactosyltransferases, consider using seed-based assays with fluorescent markers for phenotypic screening, which can save time compared to seedling-stage analysis and provide high-throughput data collection opportunities .

What techniques can be used to analyze the impact of B3GALT16 on the plant glycome?

Comprehensive glycomic analysis requires sophisticated analytical techniques:

  • Mass spectrometry approaches:

    • MALDI-TOF MS for initial glycan profiling

    • LC-MS/MS for detailed structural characterization

    • Permethylation analysis for linkage determination

  • Glycan labeling strategies:

    • Use fluorescent tags (2-AB, 2-AA) for HPLC analysis

    • Employ isotopic labeling for comparative quantitation

    • Consider metabolic labeling approaches for in vivo studies

  • Immunological methods:

    • Develop or source antibodies specific for Lewis a epitopes

    • Use enzyme-linked immunosorbent assay (ELISA) for quantitative analysis

    • Apply immunocytochemistry to determine subcellular localization of glycan structures

  • Data visualization and reporting:

    • Present glycomic data in clear, well-structured tables with appropriate statistical analysis

    • Use column formats for dependent variables to facilitate comparison between genotypes

    • Avoid excessive decimal places and standardize units for clarity

How might CRISPR/Cas9 genome editing advance research on B3GALT16 function?

CRISPR/Cas9 technology offers powerful approaches for investigating B3GALT16 function:

  • Precise gene editing strategies:

    • Generate complete knockouts through frameshift mutations

    • Create specific point mutations to test structure-function relationships

    • Introduce epitope tags at endogenous loci for protein tracking

    • Implement conditional knockout systems for temporal control

  • Multiplexed editing:

    • Target multiple galactosyltransferases simultaneously to address functional redundancy

    • Create combinatorial mutant libraries to explore genetic interactions

    • Implement base editing for precise nucleotide changes without double-strand breaks

  • Technical considerations:

    • Design multiple guide RNAs targeting different exons

    • Implement appropriate screening methods (PCR, restriction digestion, sequencing)

    • Consider using transient protoplast assays to evaluate guide RNA efficiency before stable transformation

This technology offers significant advantages over traditional T-DNA insertion or RNAi approaches, particularly in investigating genes like B3GALT16 that may have partially redundant functions with other family members.

What are the implications of understanding B3GALT16 function for synthetic biology applications?

Understanding B3GALT16 may enable novel synthetic biology applications:

  • Glycoprotein engineering:

    • Modifying plants to produce recombinant proteins with defined glycosylation patterns

    • Engineering Lewis a structures on plant-made biopharmaceuticals

    • Creating novel glycoconjugates with altered biological properties

  • Metabolic engineering approaches:

    • Redirecting glycan biosynthesis pathways toward desired products

    • Optimizing expression levels and activity through promoter engineering

    • Coupling with UDP-galactose biosynthesis for enhanced activity

  • Future research priorities:

    • Determine the three-dimensional structure of B3GALT16

    • Characterize protein-protein interactions with other glycosylation enzymes

    • Develop high-throughput screening methods for engineered variants with altered specificity or enhanced activity

When publishing research findings in this emerging field, follow best practices for data presentation, using well-constructed tables with clear titles and organized columns that facilitate comparison of dependent variables across experimental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.