Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 1 (B3GALT1)

Shipped with Ice Packs
In Stock

Description

Functional Role in N-Glycan Biosynthesis

B3GALT1 is indispensable for Le<sup>a</sup> formation, a key modification in plant glycoproteins. Its role includes:

Key Steps in Le<sup>a</sup> Biosynthesis

  1. Galactosylation: B3GALT1 adds β1,3-galactose to N-glycans (e.g., converting GnGn to Galβ1-3GnGn) .

  2. Fucosylation: α1,4-Fucosyltransferase (e.g., FUT13) attaches fucose to the galactosylated intermediate, forming Le<sup>a</sup> .

Experimental Evidence:

  • Knockout Studies: Arabidopsis plants lacking GALT1 mRNA show no detectable Le<sup>a</sup> epitopes .

  • Overexpression: Transgenic plants overexpressing GALT1 exhibit elevated Le<sup>a</sup> levels, confirmed via MALDI-TOF MS .

  • In Vitro Activity: Recombinant GALT1 produces monogalactosylated (m/z = 2223) and digalactosylated (m/z = 2385) N-glycans when incubated with UDP-galactose and glycopeptide substrates .

Comparative Analysis with Mammalian Orthologs

B3GALT1 differs from mammalian B3GALTs in structure and substrate specificity:

FeatureB3GALT1 (Plant)Mammalian B3GALTs
Lectin DomainPresent (pfam00337) Absent
Substrate SpecificityN-glycans (GnGn, GnMn) Glycolipids, proteoglycans
LocalizationGolgi apparatus Golgi and ER (varies by isoform)
Biological RoleLe<sup>a</sup> synthesis in glycoproteinsKeratan sulfate, glycosaminoglycans

Mammalian B3GALT1 (ENSG00000172318, UniProt Q9Y5Z6) shares conserved catalytic residues but lacks the lectin domain .

Research Applications and Significance

  • Glycosylation Engineering: B3GALT1 enables precise modification of plant N-glycans, relevant for biotechnology (e.g., humanizing glycoproteins) .

  • Evolutionary Insights: Phylogenetic studies reveal B3GALT1 as part of a plant-specific clade distinct from animal β1,3-galactosyltransferases .

  • Diagnostic Tools: Anti-Le<sup>a</sup> antibodies (e.g., JIM84) and MALDI-TOF MS are used to validate B3GALT1 activity in transgenic plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
B3GALT1; At1g11730; F25C20.12; Probable beta-1,3-galactosyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT1
Target Protein Sequence
MSFKNRGDYNFTPRNVVSRNSVFFMCLASFCLGMFFTNRMWNIVPEARGISRLSKLSLSS SDCDKKNVLDYGNNTIGILDKSISNLEMKLVAARAERESLSGKFNISNEAKKRKYFMVIG INTAFSSRKRRDSVRSTWMPQGENLKKLEEEKGIIVRFVIGHSVLSHGILDKAIEAEEKT HGDFLRLEHTEGYMKLSAKTKTFFATAVSLWDAEFYIKVDDDVHVNLASLKKALSAHQNK PRVYVGCMKSGPVLARKSVKYHEPEYWKFGEVGNKYFRHATGQFYAISKDLATYILINQD LLHKYANEDVSLGSWFIGLNVEHVDEKRLCCSTSQDCELKAMMGHVCAASFDWKCSGICR SAERMADVHERCGEPQNALWTSNS
Uniprot No.

Target Background

Function

Function: Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 1 (B3GALT1) is a beta-1,3-galactosyltransferase that catalyzes the transfer of galactose from UDP-galactose to substrates possessing a terminal glycosyl residue.

Database Links

KEGG: ath:AT1G11730

UniGene: At.51577

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

Basic Research Questions

  • What is Arabidopsis thaliana B3GALT1 and what is its function?

B3GALT1 (GALACTOSYLTRANSFERASE1, At1g26810) is a unique β1,3-galactosyltransferase in Arabidopsis thaliana that plays a critical role in plant glycosylation pathways. This enzyme specifically catalyzes the transfer of β1,3-linked galactose residues to N-glycans, which is essential for the biosynthesis of Lewis a epitopes [Fucα1-4(Galβ1-3)GlcNAc-R] in plants . B3GALT1 is both necessary and sufficient for this galactosylation process, as plants lacking functional B3GALT1 show no detectable Lewis a structures on their glycoproteins . The enzyme belongs to the CAZy glycosyltransferase family GT31 and contains a characteristic galactosyltransferase domain (pfam 01762) along with a galactoside binding lectin domain (pfam 00337) .

  • Where is B3GALT1 localized in plant cells?

Cell biological characterization using confocal laser scanning microscopy of transiently expressed B3GALT1-fluorescent protein fusions has revealed that B3GALT1 is exclusively localized within the Golgi apparatus of plant cells . This specific subcellular localization aligns perfectly with its physiological function in the glycosylation of proteins, as the Golgi apparatus serves as the primary site for complex glycan modifications in the secretory pathway . The precise positioning within the Golgi apparatus supports B3GALT1's role in the sequential processing of N-glycans during their transit through the secretory pathway before glycoproteins reach their final destinations .

  • What are the structural domains of B3GALT1 and how do they contribute to function?

B3GALT1 possesses a multi-domain architecture that enables its specific enzymatic function:

DomainFunctionNote
Galactosyltransferase domain (pfam 01762)Catalyzes transfer of galactose from UDP-galactose to acceptorConserved across GT31 family members
Galactoside binding lectin domain (pfam 00337)Likely involved in substrate recognitionUnique to plant B3GALTs; not found in mammalian homologs
N-terminal transmembrane domainAnchors protein to Golgi membraneSingle-pass membrane protein
N-glycosylation sitesProtein stability and foldingContains seven potential sites

The protein contains several highly conserved residues within the galactosyltransferase domain that are putatively involved in substrate binding and catalysis . The unique combination of catalytic and lectin domains distinguishes B3GALT1 from other glycosyltransferases and may explain its specific role in Lewis a epitope formation.

  • What is the expression pattern of B3GALT1 in different Arabidopsis tissues?

B3GALT1 exhibits distinct tissue-specific expression patterns that correlate with the presence of Lewis a epitopes:

TissueB3GALT1 ExpressionLewis a Epitope Presence
StemsHighStrong signal
PedicelsNot specifiedStrong signal
NodesNot specifiedStrong signal
SiliquesModerateLow signal
Shoot apexNot specifiedLow signal
FlowersNot specifiedLow signal
RootsNot specifiedLow signal
LeavesLowUndetectable

RT-PCR analyses reveal that B3GALT1 mRNA is detectable in various organs but displays higher transcript levels in stems compared to leaves . This expression pattern correlates with immunoblot analyses using JIM84 (a Lewis a-specific antibody), which show Lewis a epitopes predominantly in stems, pedicels, and nodes . This tissue-specific expression suggests B3GALT1 may have specialized roles in certain plant organs, possibly related to specific developmental or physiological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.