Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 2 (B3GALT2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Probable Beta-1,3-Galactosyltransferase 2 (B3GALT2)

Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 2 (B3GALT2) refers to a specific enzyme within the glycosyltransferase family, crucial for synthesizing complex carbohydrates in plants. B3GALT2 is involved in transferring galactose to specific acceptor molecules, influencing the structure and function of various cellular components . Understanding this enzyme is vital for manipulating plant glycosylation pathways and improving plant characteristics.

Detailed Overview of B3GALT2

B3GALT2 is a beta-1,3-galactosyltransferase that facilitates the transfer of galactose from UDP-galactose to substrates containing a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue . While it primarily uses beta-GlcNAc terminated substrates, it can also act on substrates with a terminal galactose residue, albeit with reduced efficiency . This enzyme participates in the biosynthesis of carbohydrate moieties present in glycolipids and glycoproteins .

B3GALT2 belongs to a gene family encoding type II membrane-bound glycoproteins that exhibit varied enzymatic functions. These functions involve different donor substrates such as UDP-galactose and UDP-N-acetylglucosamine and acceptor sugars like N-acetylglucosamine, galactose, and N-acetylgalactosamine .

Functional Characteristics

B3GALT2 is integral to N-linked glycoprotein glycosylation and displays a strict specificity for UDP-galactose as a donor substrate . The enzyme's activity is essential for creating type 1 carbohydrate chains, which are significant during embryogenesis .

Experimental Identification and Characterization of Arabidopsis thaliana Galactosyltransferase 1 (GALT1)

Arabidopsis thaliana Galactosyltransferase 1 (GALT1) is essential for synthesizing Lewis a epitopes, which are specific carbohydrate structures found in plants . Researchers have identified GALT1 through expression cloning, pinpointing a single gene responsible for encoding the β1,3-galactosyltransferase involved in Lewis a biosynthesis .

  • Complementation Analysis: Introduction of GALT1 into plants lacking Lewis a epitopes restores their production, confirming the gene's function .

  • Enzyme Activity: Recombinant GALT1 protein, produced in insect cells, effectively transfers β1,3-linked galactose residues to N-glycan acceptor substrates. Subsequent treatment with α1,4-fucosyltransferase results in Lewis a structure generation .

  • Genetic Evidence: Plants with a disrupted GALT1 gene show no detectable Lewis a epitopes, underscoring the gene's necessity for synthesizing these structures .

Key Research Findings

Research has demonstrated that GALT1 is both necessary and sufficient for adding β1,3-linked galactose residues to N-glycans, which is critical for Lewis a structure biosynthesis in Arabidopsis .

  • Expression Studies: Overexpressing GALT1 in Arabidopsis increases Lewis a epitope levels, whereas knocking out or downregulating the gene abolishes Lewis a structure synthesis .

  • Enzymatic Properties: Recombinant GALT1 exhibits galactosyltransferase activity, confirmed through mass spectrometry, showing its ability to act on N-glycans .

Involvement in Plant Development

Type II arabinogalactans, which include β-1,3-galactan backbones, are vital in plant physiology . Degrading these galactans in Arabidopsis leads to severe tissue disorganization, highlighting their role in maintaining cell shape and tissue integrity .

B3GALT2 Interactions

B3GALT2 interacts with several proteins that are crucial in glycosylation pathways. These interactions facilitate the synthesis of complex N-linked oligosaccharides and carbohydrate moieties of glycolipids .

  • B4GALT2: Beta-1,4-galactosyltransferase 2, responsible for synthesizing complex-type N-linked oligosaccharides and carbohydrate moieties of glycolipids .

  • FUT2: Galactoside 2-alpha-L-fucosyltransferase 2, mediates the transfer of fucose to the terminal galactose on glycan chains of cell surface glycoproteins and glycolipids .

  • FUT3: Galactoside 3(4)-L-fucosyltransferase, involved in the expression of various antigens and blood group Lewis determination .

  • B3GNT5: Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase, plays a key role in synthesizing lacto- or neolacto-series carbohydrate chains on glycolipids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
B3GALT2; At1g05170; YUP8H12.22; Probable beta-1,3-galactosyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT2
Target Protein Sequence
MSAKIKGEYSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSVTEAERLKL VSEGCNPKALYQKEVKRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNG APLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRDSIRATWMPQGEKRKRLEEEKGIIIR FVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWDADFYV KVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYF RHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDC EWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF
Uniprot No.

Target Background

Function
Beta-1,3-galactosyltransferase; catalyzes the transfer of galactose from UDP-galactose to substrates with a terminal glycosyl residue.
Database Links

KEGG: ath:AT1G05170

UniGene: At.10413

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is Arabidopsis thaliana Beta-1,3-Galactosyltransferase and what is its role in plants?

Arabidopsis thaliana Beta-1,3-Galactosyltransferase (GALT1) is a glycosyltransferase enzyme essential for the biosynthesis of Lewis a (Le^a) epitopes on N-glycans in plants. This enzyme specifically catalyzes the transfer of β1,3-linked galactose residues to N-glycan acceptor substrates using UDP-galactose as the donor substrate . GALT1 represents the only known mechanism for outer-chain elongation of complex N-glycans in plants, which involves the sequential attachment of β1,3-galactose by GALT1 followed by α1,4-fucose residues by α1,4-fucosyltransferase to form Lewis a structures . The resulting epitope structure is Fucα1-4(Galβ1-3)GlcNAc-R .

GALT1 has been definitively identified as the gene At1g26810 in Arabidopsis thaliana, and experimental evidence has demonstrated that it is both sufficient and essential for the addition of β1,3-linked galactose residues to N-glycans . This enzyme is localized exclusively within the Golgi apparatus, consistent with its role in glycoprotein modification during protein secretion .

How does GALT1 differ from other galactosyltransferases in Arabidopsis?

GALT1 belongs to a distinct subfamily of galactosyltransferases in Arabidopsis that contains unique structural and functional characteristics. Unlike many other plant glycosyltransferases, GALT1 and related family members contain a galactoside binding lectin domain (pfam 00337) in addition to the galactosyltransferase domain . This lectin domain is neither present in mammalian B3GALTs nor in other Arabidopsis candidate GALTs, suggesting a plant-specific adaptation that may influence substrate recognition or catalytic activity .

Another distinguishing feature of GALT1 is its substrate specificity. While other galactosyltransferases like AtGALT31A (At1g32930) act on arabinogalactan protein (AGP) glycans, GALT1 specifically targets N-glycans for modification . This functional specialization reflects the complex and diverse roles of glycosylation in plant development and physiology.

What methods can be used to clone and express recombinant A. thaliana GALT1 for functional studies?

To clone and express recombinant A. thaliana GALT1 for functional studies, researchers can employ the following methodological approach:

  • Gene Amplification and Cloning:

    • PCR amplification of the GALT1 coding sequence from Arabidopsis cDNA using gene-specific primers

    • Cloning into appropriate expression vectors with promoters suitable for the target expression system

    • Verification of sequence integrity through DNA sequencing

  • Heterologous Expression Systems:

    • Insect cell expression: The baculovirus expression system has been successfully used to produce functional GALT1, as demonstrated in previous studies

    • Plant expression: Overexpression in Arabidopsis under the control of the 35S promoter can be used to assess in vivo function

    • Alternative systems: Yeast or mammalian cell expression may be considered depending on research objectives

  • Protein Purification:

    • Addition of affinity tags (His, GST, or FLAG) to facilitate purification

    • Implementation of appropriate chromatography techniques based on protein properties

    • Verification of purity through SDS-PAGE and activity testing

For optimal activity assessment, recombinant GALT1 can be tested using dabsylated GnGn-peptide acceptor substrates (m/z = 2061) with UDP-galactose as the donor, followed by analysis using MALDI-TOF MS to detect mass increases of 162 D (monogalactosylated) and 324 D (digalactosylated) reaction products .

What analytical techniques are most effective for characterizing galactosyltransferase activity in vitro?

Several analytical techniques have proven effective for characterizing galactosyltransferase activity in vitro, each with specific advantages:

  • Mass Spectrometry-Based Approaches:

    • MALDI-TOF MS: This technique provides precise mass determination of reaction products, allowing for direct detection of galactosylated products. For GALT1, this method detected monogalactosylated (m/z = 2223) and digalactosylated (m/z = 2385) products, representing mass increases of 162 and 324 D respectively

    • LC-MS/MS: Offers additional structural information and can be coupled with chromatographic separation for complex mixtures

  • Immunological Detection:

    • Antibody-based detection using epitope-specific antibodies (e.g., JIM84 for Lewis a structures)

    • ELISA or Western blotting for quantitative or semi-quantitative analysis

  • Radioactive Assays:

    • Incorporation of radiolabeled UDP-galactose (UDP-[³H]Gal) as donor substrate

    • Quantification of incorporated radioactivity into acceptor substrates

  • Fluorescence-Based Assays:

    • Use of fluorescently-labeled acceptor substrates

    • Monitoring activity through changes in fluorescence properties or via HPLC

A comprehensive characterization approach typically combines multiple methods. For instance, initial activity screening might employ a radioactive assay, followed by structural confirmation using MS analysis and specificity verification through immunological detection with appropriate controls.

How does the knockout of GALT1 affect glycan profiles and plant development in Arabidopsis?

Knockout of GALT1 in Arabidopsis results in significant alterations to glycan profiles while having nuanced effects on plant development:

Effects on Glycan Profiles:

  • Complete absence of Lewis a epitopes on endogenous glycoproteins, confirming GALT1's essential role in Lewis a formation

  • Altered N-glycan patterns, specifically lacking β1,3-galactose-containing structures

  • Potential accumulation of unmodified N-glycan acceptor substrates

Developmental Consequences:
While GALT1 is essential for Lewis a epitope formation, its knockout appears less developmentally catastrophic than mutations in some other galactosyltransferases. Unlike AtGALT31A (which acts on arabinogalactan proteins and causes embryo arrest at the globular stage when mutated ), GALT1 knockout plants remain viable but with altered glycan profiles.

What is the relationship between B3GALT2 and gene dosage sensitivity in Arabidopsis?

The relationship between B3GALT2 and gene dosage sensitivity in Arabidopsis represents an intriguing aspect of gene regulation in polyploid contexts:

Galactosyltransferases like B3GALT2 may belong to gene families that exhibit dosage sensitivity, meaning their expression levels must be maintained in strict stoichiometric balance with interaction partners or pathway components. The Gene Balance Hypothesis (GBH) predicts that dosage-sensitive genes should show coordinated expression responses following genome duplication events .

Studies of Arabidopsis polyploids reveal that:

While B3GALT2 specifically hasn't been directly classified in the literature provided, galactosyltransferases often participate in multi-enzyme complexes in the Golgi, suggesting potential dosage sensitivity. Genes exhibiting characteristics of dosage sensitivity typically show:

  • Higher retention after whole-genome duplication

  • Lower retention after small-scale duplication

  • Coordinated expression with interaction partners

These patterns help maintain the balanced stoichiometry required for proper complex formation and function, which is particularly critical for enzymes involved in sequential modification pathways like glycan synthesis.

How do plant and mammalian B3GALT enzymes differ in structure and function?

Plant and mammalian B3GALT enzymes exhibit several key structural and functional differences that reflect their evolutionary divergence and adaptation to different biological contexts:

Structural Differences:

FeaturePlant B3GALT (e.g., GALT1)Mammalian B3GALT (e.g., B3GALT2)
Domain ArchitectureContains both galactosyltransferase domain and galactoside binding lectin domain (pfam 00337) Lacks the plant-specific lectin domain
Protein StructureType II membrane-bound glycoprotein with single transmembrane domain Type II membrane-bound glycoprotein
Sequence HomologyLimited sequence similarity to mammalian counterpartsGroups into at least two distinct sequence similarity clusters (B3GALT4 vs. B3GALT1-3, B3GALT5)

Functional Differences:

AspectPlant B3GALT (e.g., GALT1)Mammalian B3GALT (e.g., B3GALT2)
Primary FunctionFormation of Lewis a epitopes on N-glycans N-linked glycoprotein glycosylation with strict donor specificity for UDP-galactose
Product SpecificityProduces Fucα1-4(Galβ1-3)GlcNAc-R structures Synthesizes type 1 carbohydrate chains, as opposed to type 2 chains made by β4GalT enzymes
Developmental RoleContributes to glycan diversity with subtle developmental impactsInvolved in changing type 1:type 2 chain ratios during embryogenesis

These differences highlight the distinct evolutionary paths of plant and mammalian glycosylation systems, despite their shared catalytic function of transferring β1,3-linked galactose. The plant-specific lectin domain in GALT1 likely represents an adaptation that enhances substrate recognition or regulation in the plant cellular environment.

What methods can be used to study the subcellular localization and trafficking of B3GALT2 in plant cells?

Studying the subcellular localization and trafficking of B3GALT2 in plant cells requires sophisticated cell biological approaches:

  • Fluorescent Protein Fusion Techniques:

    • Generation of B3GALT2-GFP/YFP/RFP fusion constructs under native or constitutive promoters

    • Transfection into protoplasts for transient expression or stable transformation of whole plants

    • Confocal laser scanning microscopy for high-resolution imaging, as successfully employed for GALT1 localization to the Golgi apparatus

  • Co-localization Studies:

    • Simultaneous expression of B3GALT2-fluorescent protein fusions with established organelle markers:

      • Golgi markers (e.g., ST-RFP, ManI-YFP)

      • ER markers (e.g., HDEL-tagged fluorescent proteins)

      • Trans-Golgi network/endosomal markers (e.g., VTI12, SYP61)

    • Quantification of co-localization using Pearson's correlation coefficient or Manders' overlap coefficient

  • Dynamic Trafficking Analysis:

    • Fluorescence recovery after photobleaching (FRAP) to analyze protein mobility

    • Photoactivatable or photoconvertible fluorescent protein tags to track protein movement

    • Inhibitor treatments targeting specific trafficking pathways:

      InhibitorTarget PathwayExpected Effect on B3GALT2
      Brefeldin AER-Golgi traffickingRedistribution to ER if B3GALT2 cycles between ER and Golgi
      WortmanninVacuolar traffickingMinimal effect if B3GALT2 is Golgi-resident
      Latrunculin BActin cytoskeletonPossible effects on Golgi morphology and distribution
  • Biochemical Fractionation:

    • Subcellular fractionation followed by Western blotting or enzyme activity assays

    • Density gradient centrifugation to separate Golgi from other endomembrane compartments

    • Protease protection assays to determine membrane topology

  • Immunogold Electron Microscopy:

    • Ultrastructural localization using specific antibodies against B3GALT2 or epitope tags

    • Precise determination of localization within Golgi stacks (cis, medial, trans)

Previous research demonstrated that GALT1-GFP fusion proteins exclusively localize to the Golgi apparatus, consistent with their role in glycan processing . Similar approaches can determine whether B3GALT2 shares this localization pattern or exhibits distinct trafficking behaviors.

How can understanding B3GALT2 function contribute to glycoengineering in plants?

Understanding B3GALT2 function can significantly advance plant glycoengineering through several strategic applications:

  • Modifying N-glycan Structures for Biopharmaceutical Production:

    • Manipulation of B3GALT2 expression could allow precise control over Lewis a epitope formation on plant-produced biopharmaceuticals

    • This could help humanize plant glycans or create novel glycoforms with enhanced therapeutic properties

    • GALT1 overexpression has already been shown to increase Lewis a epitope levels in planta, demonstrating feasibility

  • Creating Glycan Structure Libraries:

    • By combining B3GALT2 expression with other glycosyltransferases, researchers could generate diverse glycan structures

    • These libraries could be valuable for studying glycan-protein interactions and developing glycan-based therapeutics

    • Systematic expression of different glycosyltransferase combinations could produce novel glycan structures not found in nature

  • Engineering Plant Stress Responses:

    • If glycan modifications mediated by B3GALT2 affect plant stress responses, modulating its expression could enhance crop resilience

    • Possible applications include engineering drought, salt, or pathogen resistance through altered cell wall or membrane glycoprotein structures

  • Metabolic Pathway Engineering:

    • Optimization of UDP-galactose availability could enhance B3GALT2 activity and increase desired glycan production

    • Coordinated engineering of multiple glycosyltransferases could redirect glycan biosynthesis toward specific end products

These applications will require integrating multiple approaches, including:

  • CRISPR/Cas9 genome editing for precise modification of B3GALT2 and related genes

  • Tissue-specific or inducible expression systems for temporal control of glycan modification

  • Metabolic engineering to optimize substrate availability

  • High-throughput screening methods to identify optimal expression conditions

What are the most promising techniques for analyzing structure-function relationships in plant galactosyltransferases?

Several cutting-edge techniques show particular promise for elucidating structure-function relationships in plant galactosyltransferases:

  • Protein Crystallography and Cryo-EM:

    • Determination of three-dimensional structures at atomic resolution

    • Visualization of substrate binding pockets and catalytic sites

    • Co-crystallization with substrates or substrate analogs to capture different catalytic states

    • Challenges include obtaining sufficient quantities of purified, stable protein and managing glycosylation heterogeneity

  • Computational Modeling and Molecular Dynamics:

    • Homology modeling based on related enzymes with known structures

    • Molecular docking to predict substrate binding modes

    • Molecular dynamics simulations to study conformational changes during catalysis

    • Identification of key residues for substrate recognition and catalysis

  • Directed Evolution and High-Throughput Screening:

    • Generation of enzyme variants through random or site-directed mutagenesis

    • Screening for altered activity, specificity, or stability

    • Yeast surface display for rapid screening of large mutant libraries

    • Deep mutational scanning to comprehensively map sequence-function relationships

  • Domain Swapping and Chimeric Enzymes:

    • Creation of hybrid enzymes between plant and mammalian B3GALTs

    • Swapping the plant-specific lectin domain with other carbohydrate-binding modules

    • Analysis of resulting changes in substrate specificity and catalytic efficiency

    • Potential strategy for engineering novel activities

  • Advanced Glycan Analysis:

    • Glycomics approaches using mass spectrometry

    • Automated glycan array screening to determine substrate preferences

    • Single-molecule enzymology to study reaction mechanisms

    • Development of activity-based probes for galactosyltransferases

TechniqueKey AdvantageMajor ChallengeRecent Implementation
Cryo-EMWorks with smaller sample quantities; captures multiple conformational statesProtein size limitations (easier with larger complexes)Successfully applied to several glycosyltransferase families
Directed EvolutionDiscovers novel functions without structural knowledgeRequires high-throughput screening methodDemonstrated for engineering glycosyltransferase specificity
Homology ModelingAccessible without crystal structureAccuracy depends on template qualityIncreasingly accurate with AI-based structure prediction tools
Domain SwappingDirectly tests functional hypothesesMay disrupt protein foldingSuccessful in identifying functional domains in related enzymes

Integrating these approaches can provide comprehensive insights into the structural determinants of specificity, catalytic mechanism, and evolutionary relationships of plant galactosyltransferases, facilitating both fundamental understanding and applied glycoengineering.

What are common challenges in expressing active recombinant plant galactosyltransferases and how can they be overcome?

Expressing functionally active plant galactosyltransferases presents several challenges that researchers should anticipate and address:

  • Protein Misfolding and Insolubility:

    • Challenge: Membrane-associated glycosyltransferases often misfold when overexpressed

    • Solutions:

      • Use specialized expression vectors with solubility-enhancing tags (MBP, SUMO, Trx)

      • Express truncated versions lacking the transmembrane domain

      • Optimize expression temperature (typically lower temperatures improve folding)

      • Include molecular chaperones as co-expression partners

  • Post-translational Modifications:

    • Challenge: Plant galactosyltransferases may require specific glycosylation for activity

    • Solutions:

      • Select expression systems capable of appropriate glycosylation (insect cells worked successfully for GALT1 )

      • Consider plant-based expression systems for authentic modifications

      • Test multiple expression hosts to identify optimal conditions

      • Evaluate enzyme activity even when glycosylation patterns differ from native forms

  • Catalytic Activity Assessment:

    • Challenge: Low activity levels or unstable enzyme preparations

    • Solutions:

      • Optimize buffer conditions (pH, ionic strength, divalent cations)

      • Include stabilizing agents (glycerol, specific detergents)

      • Ensure UDP-galactose donor quality and stability

      • Use sensitive detection methods (e.g., MALDI-TOF MS as used for GALT1 )

      • Consider enzyme immobilization to improve stability

  • Subcellular Targeting:

    • Challenge: Mislocalization affecting function in expression systems

    • Solutions:

      • For in vivo studies, verify localization using fluorescent protein fusions

      • Include appropriate targeting signals if expressing in heterologous systems

      • Consider Golgi-retention signals if secretion is problematic

  • Expression Level Optimization:

    • Challenge: Low yield of active enzyme

    • Solutions:

      Expression SystemOptimization StrategySpecific Considerations
      E. coliCodon optimization; fusion tags; lower temperatureLimited glycosylation capacity
      Insect cellsBaculovirus optimization; timing of harvestSuccessfully used for GALT1
      Plant systemsTransient vs. stable expression; appropriate promotersMost authentic environment
      YeastSelection of appropriate strain; media optimizationGlycosylation differs from plants

These approaches can be applied sequentially or in combination to overcome the specific challenges associated with plant galactosyltransferase expression.

How can researchers overcome challenges in analyzing complex glycan structures modified by B3GALT2?

Analyzing complex glycan structures modified by B3GALT2 presents technical challenges that can be addressed using specialized approaches:

  • Sample Preparation Challenges:

    • Challenge: Low abundance of specific glycan structures

    • Solutions:

      • Optimize glycoprotein extraction protocols specific for plant tissues

      • Employ glycan enrichment techniques (lectin affinity, hydrazide chemistry)

      • Consider glycan release methods appropriate for specific linkages:

        • PNGase F for N-glycans (monitoring reveals B3GALT2 activity)

        • Chemical methods (β-elimination) for O-glycans

      • Scale up starting material when analyzing low-abundance species

  • Analytical Separation Challenges:

    • Challenge: Complex mixtures with similar structures

    • Solutions:

      • Multi-dimensional chromatographic approaches:

        • HILIC (hydrophilic interaction chromatography) for glycan separation

        • UPLC with fluorescent labeling for improved resolution

        • Porous graphitized carbon chromatography for isomer separation

      • Capillary electrophoresis with laser-induced fluorescence detection

      • Ion mobility separation prior to mass spectrometry

  • Structural Characterization Challenges:

    • Challenge: Distinguishing isomeric structures and linkage positions

    • Solutions:

      • Tandem mass spectrometry (MS/MS) with collision-induced dissociation

      • Enzyme digests with specific glycosidases:

        • β1,3-galactosidase to confirm GALT1/B3GALT2 products

        • α1,4-fucosidase to verify Lewis a structures

      • NMR spectroscopy for definitive linkage analysis

      • Combination of multiple orthogonal methods for confident structure assignment

  • Quantification Challenges:

    • Challenge: Accurate quantification of specific glycan structures

    • Solutions:

      • Multiple reaction monitoring (MRM) for targeted MS quantification

      • Standardized internal standards for each glycan class

      • Isotope-labeled standards for absolute quantification

      • Antibody-based methods (glycan array, ELISA) for specific epitopes

  • Data Analysis Challenges:

    • Challenge: Complex datasets from multiple analytical platforms

    • Solutions:

      • Specialized glycomics software tools:

        • GlycoWorkbench for spectral interpretation

        • Byonic/Byologic for glycopeptide analysis

        • SimGlycan for structure prediction from MS data

      • Database integration with plant-specific glycan repositories

      • Machine learning approaches for pattern recognition in complex datasets

When applied to B3GALT2 research, these approaches enable precise determination of enzyme specificity, substrate preferences, and the biological significance of the resulting glycan structures in plant systems.

How does A. thaliana GALT1 compare with AtGALT31A in terms of structure, function, and developmental significance?

A detailed comparison between A. thaliana GALT1 and AtGALT31A reveals distinct differences in their structures, functions, and developmental significance:

Structural Comparison:

FeatureGALT1 (At1g26810)AtGALT31A (At1g32930)
Gene FamilyMember of CAZY family GT31, subfamily 1 Member of CAZY family GT31
Domain OrganizationContains galactosyltransferase domain and galactoside binding lectin domain Specific domain structure not detailed in sources, but likely differs from GALT1
Subcellular LocalizationExclusively localized to Golgi apparatus Present in Golgi apparatus, consistent with glycosylation function

Functional Comparison:

AspectGALT1 (At1g26810)AtGALT31A (At1g32930)
Substrate SpecificityActs on N-glycans, adding β1,3-galactose for Lewis a epitope formation Acts on arabinogalactan proteins (AGPs), extending β1,3-galactan backbone
Biochemical ActivityTransfers galactose from UDP-galactose to GlcNAc residues on N-glycans Involved in elongation of AGP glycan side chains
Target GlycoconjugatesN-linked glycoproteins Arabinogalactan proteins (cell surface proteoglycans)

Developmental Significance:

ImpactGALT1 (At1g26810)AtGALT31A (At1g32930)
Knockout PhenotypeNo detectable amounts of Lewis a epitopes; viable plants Embryo developmental arrest at globular stage; lethal
Key Developmental ProcessN-glycan modification with subtle developmental effectsEssential for progression of embryo development beyond globular stage
Cellular FunctionsGlycoprotein modification affecting protein functionCritical for asymmetric division of hypophysis during embryogenesis

This comparison highlights the diverse and specialized roles of galactosyltransferases in plant development. While both enzymes perform β1,3-galactosylation, their distinct substrates and impacts on development underscore the importance of protein-specific glycosylation in plant biology. AtGALT31A appears to be more critical for basic developmental processes, while GALT1 has more specialized roles in glycan diversification.

What insights can be gained from comparing plant and mammalian B3GALT enzyme functions in their respective biological systems?

Comparing plant and mammalian B3GALT enzyme functions provides valuable insights into evolutionary conservation, divergence, and the biological significance of these enzymes:

  • Evolutionary Conservation and Divergence:

    • Conserved Catalytic Mechanism: Both plant and mammalian B3GALT enzymes catalyze the transfer of β1,3-linked galactose, suggesting an ancient origin for this enzymatic function

    • Divergent Domain Architecture: Plant B3GALTs contain a unique galactoside-binding lectin domain absent in mammalian counterparts, indicating evolutionary adaptation to different cellular environments

    • Shared Topology: Both are type II membrane-bound glycoproteins with similar general organization, reflecting conservation of basic structural features

  • Substrate Specificity and Glycan Diversity:

    • Glycan Repertoire: Mammalian B3GALT enzymes contribute to a more diverse array of glycan structures, including those on glycolipids, while plant B3GALTs like GALT1 appear more specialized for specific epitopes like Lewis a

    • Type 1 vs. Type 2 Chains: Mammalian systems have clear differentiation between type 1 chains (β1,3-linkages) and type 2 chains (β1,4-linkages), with developmental regulation of their ratio

    • Functional Redundancy: Mammals have multiple B3GALT enzymes with partially overlapping functions, while plants appear to have more specialized enzymes for specific glycan types

  • Developmental Significance:

    • Critical Developmental Windows: Both kingdoms show developmental regulation of glycosylation, but with different patterns and consequences

    • Embryogenesis: In plants, some galactosyltransferases like AtGALT31A are essential for early embryo development , while in mammals, B3GALT enzymes contribute to changing glycan profiles during embryogenesis

    • System-Specific Adaptations: Plant galactosyltransferases may have evolved specialized roles in cell wall glycoprotein modification, while mammalian enzymes adapted for immune system functions and cell-cell interactions

  • Regulatory Mechanisms:

    • Gene Dosage Sensitivity: Plant galactosyltransferases may be subject to dosage balance constraints following genome duplication , which could differ from mammalian regulatory patterns

    • Expression Patterns: Tissue-specific and developmental regulation likely evolved independently in plants and mammals to serve kingdom-specific biological needs

These comparative insights suggest that while the basic catalytic function of B3GALT enzymes is conserved across kingdoms, their specific biological roles, regulatory mechanisms, and structural features have diverged significantly to serve the unique needs of plant and animal biology. This evolutionary divergence provides opportunities for both fundamental research into glycan evolution and applied biotechnology leveraging the unique properties of plant glycosylation systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.