Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 4 (B3GALT4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
B3GALT4; At4g26940; F10M23.280; Probable beta-1,3-galactosyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT4
Target Protein Sequence
MSLKHHHRGLELSASKSFVSKKWTLFLCIGFFCAGILFSDRMWPEPESNVVSRDTVASDE RLRLESEDCDSSKKGLKRESKDILGDVYKSPDAIQTLDKTISKLETELADARAAQESIMN GSPVSDDFKLPETVTKRKYLMVVGVNTAFSSRKRRDSVRATWMPPGEERKKLEEEKGIVM RFVIGHSSTPGGILDRAIQAEESKHGDFLRLDHVEGYLELSAKTKTYFTTAFAMWDADFY VKVDDDVHVNIATLGAELARYRMKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEEGNKY FRHATGQLYAISRELASYISINQNVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGTTDC EWKAQAGNICVASFDWSCSGICRSADRMKDVHRRCGEGEKALLAASF
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Probable beta-1,3-galactosyltransferase 4 (B3GALT4) is a beta-1,3-galactosyltransferase that catalyzes the transfer of galactose from UDP-galactose to substrates possessing a terminal glycosyl residue.
Database Links

KEGG: ath:AT4G26940

STRING: 3702.AT4G26940.1

UniGene: At.22123

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the function of beta-1,3-galactosyltransferases in Arabidopsis thaliana?

Beta-1,3-galactosyltransferases catalyze the transfer of galactose residues to acceptor substrates with a beta-1,3 linkage. In Arabidopsis thaliana, these enzymes serve multiple critical functions:

  • Modification of N-glycans by adding β1,3-galactose residues, which is essential for the formation of Lewis a [Fucα1-4(Galβ1-3)GlcNAc-R] structures

  • Biosynthesis of the type II arabinogalactan chains on arabinogalactan-proteins (AGPs), which are important structural components of plant cell walls

  • Specific family members like GALT1 (At1g26810) are indispensable for Lewis a epitope formation on N-glycans

The addition of these galactose residues creates recognition structures on glycoproteins that may play roles in plant development, stress responses, and cell-cell communication.

How many putative beta-1,3-galactosyltransferases exist in the Arabidopsis thaliana genome?

Bioinformatic analyses have revealed a substantial family of putative beta-1,3-galactosyltransferases in Arabidopsis thaliana:

  • 20 members of the CAZy GT-family-31 contain domains/motifs typical of biochemically characterized beta-(1,3)-GTs from mammalian systems

  • These enzymes are distributed throughout the Arabidopsis genome and show diverse expression patterns across tissues

  • Known characterized members include GALT1 (At1g26810) involved in Lewis a epitope biosynthesis and At1g77810, which has demonstrated beta-(1,3)-GalT activity in preliminary studies

The large number of putative β1,3-GalTs suggests functional specialization or redundancy across different developmental stages and tissue types.

What experimental evidence confirms the galactosyltransferase activity of recombinant Arabidopsis B3GALT4?

While the search results do not specifically address B3GALT4 activity in Arabidopsis, the experimental approach used to characterize other beta-1,3-galactosyltransferases provides a methodological framework:

  • Recombinant expression in appropriate eukaryotic systems (such as insect cells) that permit proper protein folding and post-translational modifications

  • In vitro enzyme assays using purified recombinant protein with appropriate acceptor substrates and UDP-galactose as donor

  • MALDI-TOF MS analysis to detect mass shifts corresponding to galactose addition (162 D for each galactose residue)

  • Sequential enzymatic treatments to verify the linkage specificity and compatibility with downstream glycosylation steps

For example, when recombinant GALT1 was incubated with a glycopeptide acceptor substrate (dabsylated GnGn-peptide) and UDP-galactose, MALDI-TOF MS analysis revealed peaks with mass increases of 162 and 324 D, representing monogalactosylated and digalactosylated products respectively .

What is the subcellular localization of beta-1,3-galactosyltransferases in Arabidopsis thaliana?

Beta-1,3-galactosyltransferases in Arabidopsis thaliana are typically localized to the secretory pathway, specifically:

  • Located in the Golgi apparatus, which is consistent with their role in processing secreted and membrane glycoproteins

  • This localization has been experimentally confirmed for At1g77810, a member of the GT-31 family with demonstrated beta-(1,3)-GalT activity

  • The Golgi localization is expected given that glycan modifications of this type typically occur as proteins transit through the secretory pathway

This subcellular localization is critical for their function, as it positions these enzymes to act on glycoproteins after their initial glycosylation in the endoplasmic reticulum but before their final destination in the cell membrane or extracellular space.

How are expression patterns of beta-1,3-galactosyltransferases regulated across different Arabidopsis tissues?

The expression patterns of beta-1,3-galactosyltransferases vary significantly across Arabidopsis tissues, suggesting tissue-specific regulation:

  • Microarray data confirm that members of the GT-31 family are expressed throughout all tissues, but with varying intensities

  • For GALT1 (At1g26810), RT-PCR analysis revealed higher transcript levels in stems compared to leaves, which correlated with stronger Lewis a immunoblot signals in stem tissues

  • This differential expression pattern suggests that these enzymes may have specialized roles in different plant tissues

Tissue TypeGALT1 (At1g26810) ExpressionLewis a Signal Intensity
StemsHighStrong
LeavesLowWeak
SiliquesVariableVariable

The tissue-specific expression patterns likely reflect the differential requirements for specific glycan structures in various plant organs and developmental stages.

What are the effects of genetic manipulation (overexpression/knockdown) of beta-1,3-galactosyltransferases in Arabidopsis?

Genetic manipulation studies provide important insights into the functional roles of beta-1,3-galactosyltransferases:

For GALT1 (At1g26810):

  • Overexpression under the control of the cauliflower mosaic virus 35S promoter increased Lewis a epitope levels in planta

  • Knockout or selective downregulation by RNA interference abolished the synthesis of Lewis a structures

  • These results demonstrate that GALT1 is both sufficient and essential for the addition of β1,3-linked galactose residues to N-glycans and thus required for Lewis a biosynthesis

By analogy, similar approaches could be applied to study B3GALT4 function in Arabidopsis, potentially revealing its specific roles in glycan modification and plant development.

What bioinformatic approaches are effective for identifying and characterizing novel beta-1,3-galactosyltransferases in Arabidopsis?

Successful bioinformatic strategies for identifying beta-1,3-galactosyltransferases in Arabidopsis include:

  • Sequence homology searches against known galactosyltransferases from plants and other organisms

  • Identification of conserved domains/motifs typical of biochemically characterized beta-(1,3)-GTs

  • Analysis of the CAZy (Carbohydrate-Active enZYmes) database, particularly focusing on the GT-31 family

  • Integration of expression data from microarrays to identify candidates likely involved in specific biological processes

  • Structural prediction and protein modeling to assess catalytic site conservation

This systematic approach has successfully identified 20 members of the GT-31 family in Arabidopsis that contain domains/motifs typical of beta-(1,3)-GTs .

How do plant beta-1,3-galactosyltransferases differ structurally and functionally from their mammalian counterparts?

While plant and mammalian beta-1,3-galactosyltransferases share some basic catalytic mechanisms, they exhibit significant differences:

Structural differences:

Functional differences:

  • Mammalian B3GALT4 (particularly in humans) plays roles in tumor biology, regulating GD2 expression and lipid raft formation

  • Human B3GALT4 overexpression can inhibit tumor progression and promote CD8+ T-cell recruitment via chemokines CXCL9 and CXCL10

  • In contrast, plant beta-1,3-galactosyltransferases like GALT1 are primarily involved in the biosynthesis of specific glycan structures such as Lewis a epitopes on N-glycans

These differences highlight the evolutionary divergence of glycosylation pathways between plants and animals, despite the conservation of basic enzymatic mechanisms.

What are the technical challenges in expressing and purifying active recombinant beta-1,3-galactosyltransferases from Arabidopsis?

Producing active recombinant beta-1,3-galactosyltransferases presents several technical challenges:

  • These enzymes are typically membrane-bound proteins localized to the Golgi apparatus, making solubilization and purification difficult

  • Proper folding and post-translational modifications are critical for activity, necessitating expression in eukaryotic systems

  • For successful expression of active GALT1, insect cell expression systems were employed

  • Enzyme assays require specific acceptor substrates that may not be commercially available and need to be synthesized

  • Detection of activity often requires specialized analytical techniques like MALDI-TOF MS to detect the addition of galactose residues

When establishing an expression system for B3GALT4 or related enzymes, researchers should consider:

  • Truncating transmembrane domains while preserving catalytic regions

  • Including appropriate purification tags that don't interfere with activity

  • Optimizing expression conditions to maximize protein folding and stability

  • Developing sensitive and specific activity assays

How can recombinant beta-1,3-galactosyltransferases be used for in vitro glycan synthesis?

Recombinant beta-1,3-galactosyltransferases offer valuable tools for controlled glycan synthesis applications:

  • Enzymatic synthesis of complex glycans with defined structures that would be challenging to produce through chemical methods

  • Generation of substrates for studying downstream glycosylation events or glycan-binding proteins

  • Production of glycoconjugates with specific modifications for functional studies

A methodological approach for in vitro glycan synthesis includes:

  • Expression and purification of active recombinant enzyme

  • Preparation of acceptor substrates (glycopeptides or free glycans)

  • Reaction setup with UDP-galactose donor and appropriate buffer conditions

  • Analysis of reaction products using MALDI-TOF MS or other analytical techniques

  • Sequential enzymatic modifications with additional glycosyltransferases as needed

For example, recombinant GALT1 produced in insect cells successfully transferred galactose residues to N-glycan substrates, and subsequent treatment with α1,4-fucosyltransferase resulted in Lewis a structure formation .

What strategies can resolve contradictory data regarding beta-1,3-galactosyltransferase function in Arabidopsis?

When faced with contradictory data about beta-1,3-galactosyltransferase function, researchers should consider:

Methodological approaches to resolve discrepancies:

  • Genetic redundancy analysis: Create and analyze multiple gene knockouts to address potential functional redundancy among family members

  • Tissue-specific studies: Investigate enzyme function in specific tissues where expression is highest

  • Developmental stage considerations: Examine function across different developmental stages

  • Environmental condition variations: Test under different growth conditions that might affect glycosylation requirements

  • Substrate specificity verification: Confirm enzyme-substrate relationships using multiple analytical approaches

Complementary experimental strategies:

  • In vitro biochemical characterization with purified recombinant enzymes

  • In vivo genetic studies (knockouts, overexpression)

  • Structural analysis of glycans from wild-type and mutant plants

  • Subcellular localization studies to confirm proper targeting

How can CRISPR-Cas9 technology be optimized for studying beta-1,3-galactosyltransferase function?

CRISPR-Cas9 technology offers powerful approaches for investigating beta-1,3-galactosyltransferase function in Arabidopsis:

Experimental design considerations:

  • Design guide RNAs targeting conserved catalytic domains to ensure loss of function

  • Create multiplex CRISPR systems to target several related family members simultaneously to overcome functional redundancy

  • Implement tissue-specific or inducible CRISPR systems for studying enzymes that might be essential for plant viability

  • Generate precise point mutations in catalytic residues rather than complete knockouts to study structure-function relationships

Validation and analysis approaches:

  • Confirm editing efficiency through sequencing

  • Verify altered glycan profiles using mass spectrometry

  • Assess phenotypic consequences across development

  • Perform complementation studies with wild-type or mutated versions

This approach would be particularly valuable for studying B3GALT4 and related enzymes where traditional knockout approaches might be complicated by gene family redundancy.

What analytical techniques are most effective for characterizing glycan structures modified by beta-1,3-galactosyltransferases?

Several complementary analytical techniques are essential for comprehensive characterization of glycan structures:

TechniqueApplicationAdvantages
MALDI-TOF MSMass analysis of intact glycansDetects mass shifts corresponding to galactose addition (162 D)
LC-MS/MSDetailed structural analysisProvides linkage and sequence information
NMR spectroscopyDefinitive linkage analysisConfirms specific glycosidic bond configurations
HPAEC-PADQuantitative glycan analysisHigh sensitivity for neutral and charged glycans
Glycosidase digestionsLinkage confirmationEnzymatic specificity helps confirm structures
Lectin binding assaysEpitope verificationConfirms presence of specific glycan structures

For example, MALDI-TOF MS was successfully used to detect the addition of galactose residues to N-glycan substrates by recombinant GALT1, revealing peaks with mass increases of 162 and 324 D for mono- and di-galactosylated products .

How might environmental stresses affect beta-1,3-galactosyltransferase expression and function?

While the search results don't directly address environmental stress effects on beta-1,3-galactosyltransferases in Arabidopsis, research in this area would likely consider:

Potential stress responses:

  • Drought, salt, or temperature stress may alter glycosylation requirements for cell wall and membrane proteins

  • Pathogen exposure might induce changes in specific glycan structures important for immune responses

  • Nutrient availability could influence UDP-galactose pools and thus enzyme activity

Research methodologies:

  • Transcriptomic analysis of beta-1,3-galactosyltransferase expression under various stress conditions

  • Glycomic profiling to identify stress-induced changes in glycan structures

  • Comparative analysis of wild-type versus knockout/overexpression lines under stress conditions

  • Biochemical characterization of enzyme activity parameters under stress-mimicking conditions in vitro

The identification of stress-responsive beta-1,3-galactosyltransferases could provide insights into plant adaptation mechanisms and potential targets for improving stress resilience.

What evolutionary insights can be gained from comparative analysis of beta-1,3-galactosyltransferases across plant species?

Comparative analysis of beta-1,3-galactosyltransferases across plant species can reveal important evolutionary patterns:

  • Identification of conserved versus species-specific family members

  • Correlation between enzyme diversification and glycan structural complexity across plant lineages

  • Insights into the evolutionary origin of plant-specific glycan structures

Research approaches could include:

  • Phylogenetic analysis of GT-31 family members across diverse plant species

  • Functional complementation studies using orthologs from different plant species

  • Comparative analysis of enzyme substrate specificities

  • Correlation of enzyme evolution with ecological adaptations

Such studies would help place Arabidopsis B3GALT4 and related enzymes in an evolutionary context, potentially revealing how these enzymes have adapted to fulfill species-specific functions.

How might synthetic biology approaches utilize recombinant beta-1,3-galactosyltransferases for novel applications?

Recombinant beta-1,3-galactosyltransferases offer exciting potential for synthetic biology applications:

Engineering possibilities:

  • Design of artificial glycosylation pathways by combining enzymes from different organisms

  • Production of novel glycan structures with potential pharmaceutical applications

  • Development of biosensors based on glycan-modifying enzymes

  • Creation of plants with enhanced stress tolerance through modified cell wall glycans

Implementation strategies:

  • Expression of optimized enzyme variants with improved catalytic properties

  • Assembly of multi-enzyme complexes for efficient sequential glycan modification

  • Compartmentalization of glycan synthesis pathways in synthetic organelles

  • Coupling glycan modification to specific cellular signals or environmental cues

By harnessing the catalytic capabilities of enzymes like B3GALT4, researchers could create novel glycan structures with unique properties for both fundamental research and biotechnological applications.

What insights from tumor-associated B3GALT4 function in mammals might inform plant research directions?

The role of B3GALT4 in human neuroblastoma provides intriguing parallels that could inform plant research:

Transferable research concepts:

  • In neuroblastoma, B3GALT4 overexpression inhibits tumor progression and enhances CD8+ T cell recruitment via chemokines CXCL9 and CXCL10

  • B3GALT4 regulates GD2 expression and lipid raft formation, affecting downstream signaling pathways

  • B3GALT4 expression correlates with clinical outcomes in neuroblastoma patients

Potential applications to plant research:

  • Investigation of lipid raft formation and organization in plant membranes as influenced by specific glycan structures

  • Examination of plant beta-1,3-galactosyltransferase roles in cell-cell communication and signaling

  • Study of glycan-mediated responses to pathogens, potentially involving immune-like signaling cascades

  • Exploration of membrane microdomain organization as influenced by specific glycan structures

While plant and animal systems differ significantly, the fundamental principles of how glycan structures influence membrane organization and signaling may share common mechanisms worthy of investigation.

What are the most significant unanswered questions about beta-1,3-galactosyltransferases in Arabidopsis thaliana?

Despite significant progress in characterizing certain beta-1,3-galactosyltransferases like GALT1 in Arabidopsis, several important questions remain:

  • What are the specific functions of each of the 20 putative beta-1,3-galactosyltransferases identified in the Arabidopsis genome?

  • How do these enzymes coordinate their activities to generate the diverse array of glycan structures found in different plant tissues?

  • What regulatory mechanisms control the expression and activity of these enzymes during development and in response to environmental challenges?

  • How do plant-specific glycan structures generated by these enzymes contribute to unique aspects of plant biology?

  • What structural features determine the substrate specificities of different family members?

Addressing these questions will require integrated approaches combining genomics, biochemistry, structural biology, and plant physiology to fully understand the roles of these enzymes in plant glycobiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.