Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 5 (B3GALT5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
B3GALT5; At1g22015; F2E2.6; Probable beta-1,3-galactosyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
B3GALT5
Target Protein Sequence
MKHNNKVSKRLTMTWVPLLCISCFFLGAIFTSKLRSASSDSGSQLILQHRRDQELKIVTQ DYAHEKKKSQDNDVMEEVLKTHKAIESLDKSVSMLQKQLSATHSPQQIVNVSATNSSTEG NQKNKVFMVIGINTAFSSRKRRDSLRETWMPQGEKLEKLEKEKGIVVKFMIGHSSTPNSM LDKEIDSEDAQYNDFFRLDHVEGYYNLSAKTKSFFSSAVAKWDAEFYVKIDDDVHVNLGT LASTLASHRSKPRVYIGCMKSGPVLTKKTAKYREPEFWKFGEEGNKYFRHATGQIYAISK DLATYISNNQPILHKYANEDVTLGSWFIGLEVEQIDDRNFCCGTPPDCEMRAEAGEMCVA TFDWKCSGVCRSVDRMWMVHVMCGEGSKAVWDANLKLS
Uniprot No.

Target Background

Function

Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.

Database Links

KEGG: ath:AT1G22015

STRING: 3702.AT1G22015.1

UniGene: At.41628

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the functional role of B3GALT5 in Arabidopsis thaliana?

B3GALT5 in Arabidopsis thaliana is a glycosyltransferase involved in glycosphingolipid (GSL) biosynthesis pathways. Similar to its human ortholog, plant B3GALT5 likely catalyzes the addition of β1-3 galactose to specific substrates, contributing to the biosynthesis of glycan core structures. In plant development, B3GALT5 may play important roles in cell-cell recognition, signaling pathways, and potentially in stress responses. Based on research with human B3GALT5, the Arabidopsis ortholog likely participates in the synthesis of specific glycan structures that influence cellular properties and developmental processes. The enzyme's activity affects glycoconjugate profiles that are critical during different stages of plant development, particularly during seed maturation .

How does Arabidopsis thaliana B3GALT5 differ structurally from its human counterpart?

While both the human and Arabidopsis B3GALT5 proteins serve as beta-1,3-galactosyltransferases, there are notable structural differences. The human version has a molecular weight of approximately 35.2 kDa , while the Arabidopsis ortholog may differ in size due to evolutionary divergence. Sequence alignment analyses typically reveal conserved catalytic domains essential for galactosyltransferase activity, but plant-specific regions likely evolved to accommodate substrate preferences unique to plant glycobiology. The Arabidopsis version may contain plant-specific regulatory elements and targeting sequences that direct the protein to appropriate cellular compartments within plant cells, such as the Golgi apparatus where glycosylation typically occurs.

What expression patterns does B3GALT5 show during Arabidopsis development?

B3GALT5 expression in Arabidopsis likely follows tissue-specific and developmental stage-dependent patterns. Similar to other glycosyltransferases involved in complex glycan biosynthesis, B3GALT5 expression may be particularly pronounced during seed development and maturation. This pattern would align with observations that regulatory networks controlling seed development, such as those involving the transcription factor ABSCISIC ACID INSENSITIVE3 (ABI3), influence the expression of various genes essential for seed maturation and desiccation tolerance . Temporal regulation of B3GALT5 expression may coincide with specific developmental windows when particular glycan structures are required for cellular differentiation or environmental adaptation.

What expression systems are most effective for producing recombinant Arabidopsis thaliana B3GALT5?

For recombinant expression of Arabidopsis thaliana B3GALT5, several expression systems can be considered, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, low cost, high protein yieldMay lack proper folding and post-translational modifications for plant glycosyltransferases5-50 mg/L culture
Baculovirus-insect cellsBetter post-translational modifications, suitable for eukaryotic proteinsHigher cost, more complex methodology1-10 mg/L culture
Plant-based systemsNative-like post-translational modificationsLower yield, longer production time0.1-1 mg/g biomass
Yeast (P. pastoris)Glycosylation capability, high-density cultivationGlycosylation patterns differ from plants1-5 mg/L culture

The baculovirus-insect cell system, successfully used for human B3GALT5 expression , represents a good compromise for plant glycosyltransferases as it provides appropriate eukaryotic processing while offering reasonable yields. For full enzymatic activity, consider using eukaryotic expression systems that can perform the proper folding and post-translational modifications required for glycosyltransferases .

What are the optimal purification strategies for recombinant Arabidopsis B3GALT5?

Purification of recombinant Arabidopsis B3GALT5 should employ a multi-step approach for achieving high purity and yield:

  • Affinity Chromatography: If expressed with an affinity tag such as His-tag (as employed for human B3GALT5 ), use nickel or cobalt affinity resins. For optimal elution, employ a 20 mM Tris, 150 mM NaCl buffer at pH 8.0 with an imidazole gradient.

  • Size Exclusion Chromatography: Follow affinity purification with gel filtration to separate monomeric protein from aggregates and further remove contaminants.

  • Ion Exchange Chromatography: Consider this as an additional step, particularly if the isoelectric point of Arabidopsis B3GALT5 differs significantly from contaminants.

  • Quality Control: Confirm protein purity using SDS-PAGE (targeting >95% purity ) and verify identity via Western blotting with anti-B3GALT5 antibodies or mass spectrometry.

For storage stability, lyophilize the purified protein in a protective formulation containing 5-8% trehalose, mannitol, and 0.01% Tween 80 , or store at -80°C in solution with 10-20% glycerol to maintain enzymatic activity.

How can I confirm the enzymatic activity of recombinant Arabidopsis B3GALT5?

To validate the catalytic activity of recombinant Arabidopsis B3GALT5, implement the following assay strategies:

  • Radioactive Assay: Use UDP-[14C]galactose or UDP-[3H]galactose as donor substrates and appropriate acceptors (such as lactosylceramide). Measure transferred radioactivity to quantify enzymatic activity.

  • HPLC/MS-Based Assays: Monitor the conversion of acceptor substrates and formation of galactosylated products using HPLC coupled with mass spectrometry.

  • Colorimetric/Fluorometric Assays: Employ coupled enzyme systems that produce detectable signals upon galactose transfer.

  • Comparative Analysis: Test activity against known B3GALT5 substrates identified from human studies, such as Gb4Cer/Lc3Cer structures, which serve as substrates for β1–3 galactose addition .

Activity assessment should include both reaction kinetics determination (Km, Vmax) and substrate specificity testing. Compare results with positive controls (such as human B3GALT5) to benchmark the activity levels. Recombinant protein activity can vary based on expression system and purification method, so optimization may be required to achieve maximal enzymatic function .

What experimental approaches are recommended for studying B3GALT5 function in Arabidopsis?

To comprehensively investigate B3GALT5 function in Arabidopsis, implement these complementary experimental approaches:

  • Gene Knockout/Knockdown Studies: Generate CRISPR/Cas9 knockout lines or RNAi knockdown plants to assess phenotypic consequences of B3GALT5 deficiency. Analyze changes in development, stress responses, and glycosphingolipid profiles.

  • Glycomic Profiling: Employ mass spectrometry (MS/MS) to characterize changes in glycosphingolipid and glycoprotein profiles in wild-type versus B3GALT5-deficient plants. Focus on detecting alterations in structures containing β1-3 galactose linkages .

  • Transcriptomic Analysis: Conduct RNA-sequencing to identify genes co-regulated with B3GALT5 during development, particularly during seed maturation. This approach revealed dramatic changes in gene expression profiles when B3GALT5 was knocked out in human stem cells .

  • Reporter Gene Fusions: Create B3GALT5 promoter-reporter constructs to monitor spatiotemporal expression patterns throughout plant development.

  • Protein Interaction Studies: Identify protein partners using co-immunoprecipitation and mass spectrometry or yeast two-hybrid screening to understand how B3GALT5 interacts with other glycosylation machinery components.

  • Subcellular Localization: Determine the precise subcellular localization using fluorescent protein fusions and co-localization with known Golgi markers.

These approaches, when combined, provide a comprehensive understanding of B3GALT5 function within the context of plant development and cellular glycobiology.

How do I design effective substrate specificity assays for Arabidopsis B3GALT5?

Designing rigorous substrate specificity assays for Arabidopsis B3GALT5 requires careful consideration of potential substrates and assay conditions:

  • Substrate Panel Selection: Based on knowledge from human B3GALT5 studies, include a diverse panel of potential acceptor substrates including:

    • Lactosylceramide analogs

    • Gb4Cer and Lc3Cer structures

    • Synthetic glycans with terminal GlcNAc or GalNAc residues

    • Plant-specific glycolipids and glycoproteins

  • Assay Optimization:

    • Test multiple buffer systems (MES, MOPS, Tris) at pH range 6.0-7.5

    • Evaluate divalent cation requirements (Mn²⁺, Mg²⁺)

    • Optimize temperature (20-30°C for plant enzymes)

    • Determine optimal donor substrate (UDP-galactose) concentrations

  • Detection Methods:

    • Employ mass spectrometry to definitively identify reaction products

    • Use HPLC with fluorescent-labeled substrates for quantitative analysis

    • Consider coupled assays that detect UDP release as an indirect measure of activity

  • Kinetic Analysis: Determine Km and Vmax values for each potential substrate to create a substrate preference profile. Calculate catalytic efficiency (kcat/Km) to identify the most relevant physiological substrates.

Compare the substrate specificity profile of Arabidopsis B3GALT5 with that of the human ortholog to identify conserved features and plant-specific adaptations that may reflect their respective biological roles in different organisms.

What is known about the regulation of B3GALT5 activity in plants?

The regulation of B3GALT5 in plants likely occurs at multiple levels, though direct evidence specific to Arabidopsis B3GALT5 is limited. Based on studies of related glycosyltransferases and the human B3GALT5:

  • Transcriptional Regulation: Plant B3GALT5 expression may be controlled by transcription factors involved in seed development and maturation. In Arabidopsis, transcription factors such as ABSCISIC ACID INSENSITIVE3 (ABI3), which regulates numerous genes during seed development , might influence B3GALT5 expression.

  • Post-transcriptional Regulation: Alternative splicing and miRNA-mediated regulation could provide additional control mechanisms, particularly during developmental transitions.

  • Post-translational Modifications: Phosphorylation, glycosylation, or other modifications may modulate enzyme activity and stability. These modifications often respond to environmental cues or developmental signals.

  • Substrate Availability: The activity of B3GALT5 is inherently regulated by the availability of donor (UDP-galactose) and acceptor substrates, which fluctuate during development and stress responses.

  • Protein-Protein Interactions: Interactions with other glycosyltransferases or regulatory proteins could influence enzymatic activity, possibly forming functional complexes within the Golgi apparatus.

Research on related glycosyltransferases suggests that B3GALT5 likely operates within a complex regulatory network that coordinates glycan biosynthesis with changing cellular needs throughout plant development and in response to environmental challenges.

How does B3GALT5 function relate to seed development and drought tolerance in Arabidopsis?

The relationship between B3GALT5 function and seed development in Arabidopsis likely involves complex glycan modifications that contribute to desiccation tolerance and seed viability:

  • Glycan-Mediated Protection: By synthesizing specific glycosphingolipids and glycoproteins, B3GALT5 may contribute to protective mechanisms that shield embryonic structures during seed desiccation. This function would align with the known role of the ABI3 regulatory network in protecting embryonic structures from desiccation damage .

  • Cell Wall Modifications: B3GALT5-mediated glycosylation may influence cell wall properties during seed maturation, affecting permeability and mechanical resilience during drying and rehydration cycles.

  • Signaling Pathways: Glycosphingolipids produced via B3GALT5 activity may serve as signaling molecules or membrane components that mediate responses to abscisic acid (ABA), a key hormone in drought response and seed maturation.

  • Membrane Stabilization: Specific glycolipids containing β1-3 galactose linkages could contribute to membrane stability during water loss, similar to how altered glycosphingolipid profiles in human cells affect cellular properties .

To investigate these relationships experimentally, researchers should compare wild-type and B3GALT5-deficient Arabidopsis lines for seed germination efficiency, desiccation tolerance, ABA sensitivity, and comprehensive glycolipid profiling during seed development and drought stress conditions.

What techniques are recommended for analyzing changes in glycosphingolipid profiles resulting from B3GALT5 manipulation?

For comprehensive analysis of glycosphingolipid (GSL) profiles following B3GALT5 manipulation in Arabidopsis, implement these state-of-the-art analytical techniques:

  • Lipidomic Mass Spectrometry:

    • Employ MALDI-TOF MS and ESI-MS/MS for initial GSL profiling

    • Use LC-MS/MS with multiple reaction monitoring for quantitative analysis

    • Implement ion mobility MS for separation of isomeric structures

  • Structural Characterization:

    • Utilize permethylation and other derivatization methods to enhance structural information

    • Apply exoglycosidase digestion arrays to confirm linkage types

    • Integrate MS fragmentation patterns to determine sugar sequence and branching

  • Comparative Analysis Workflow:

Analysis StageMethodologyExpected Outcomes
ExtractionModified Bligh-Dyer method with optimized solvent systemsComprehensive GSL isolation
SeparationHPTLC and HILIC-based chromatographyGSL class fractionation
DetectionMS/MS with specific parent/fragment transitionsStructural determination
QuantificationInternal standard normalizationRelative abundance changes
VisualizationMultivariate statistical analysis (PCA, hierarchical clustering)Pattern recognition
  • Imaging Techniques:

    • Apply MALDI imaging mass spectrometry to localize GSLs in plant tissues

    • Use immunofluorescence with GSL-specific antibodies to visualize cellular distribution

When interpreting results, pay particular attention to changes in globo- and lacto-series GSLs, as these are specifically affected by B3GALT5 activity in human cells . Monitor shifts from type 1 (Galβ1–3GlcNAc) to type 2 (Galβ1–4GlcNAc) chain structures, which may occur when B3GALT5 function is disrupted and alternative pathways become dominant .

How can I investigate potential interactions between B3GALT5 and the plant abscisic acid signaling pathway?

To explore interactions between B3GALT5 and abscisic acid (ABA) signaling in Arabidopsis, implement this multi-faceted research strategy:

  • Transcriptional Response Analysis:

    • Examine B3GALT5 expression changes in response to exogenous ABA application

    • Analyze B3GALT5 expression in ABA-deficient and ABA-insensitive mutants

    • Investigate if B3GALT5 is regulated by ABI3 or other ABA-responsive transcription factors

  • Genetic Interaction Studies:

    • Generate double mutants between B3GALT5 knockout lines and key ABA signaling components

    • Perform genetic complementation tests to determine epistatic relationships

    • Analyze phenotypic consequences under normal and stress conditions

  • Biochemical Approaches:

    • Conduct co-immunoprecipitation experiments to identify physical interactions with ABA signaling proteins

    • Implement chromatin immunoprecipitation (ChIP) to determine if ABA-responsive transcription factors bind to the B3GALT5 promoter

    • Analyze changes in glycosphingolipid profiles in response to ABA treatment

  • Functional Assays:

    • Compare ABA sensitivity between wild-type and B3GALT5-deficient plants using:

      • Germination inhibition assays

      • Root growth inhibition tests

      • Stomatal closure measurements

      • Drought survival experiments

  • Cellular Imaging:

    • Employ fluorescent reporters to visualize ABA-induced changes in B3GALT5 localization

    • Monitor membrane dynamics and protein trafficking in response to ABA in wild-type versus B3GALT5-deficient plants

Particular attention should be paid to potential connections with the ABI3 regulatory network, as ABI3 is a key transcription factor in ABA responses during seed maturation , and changes in membrane glycolipid composition might affect the sensitivity of cells to ABA signaling molecules.

What strategies can overcome low solubility or activity of recombinant Arabidopsis B3GALT5?

Addressing solubility and activity challenges with recombinant Arabidopsis B3GALT5 requires systematic optimization at multiple levels:

  • Expression Construct Optimization:

    • Remove the predicted transmembrane domain while retaining the catalytic domain

    • Test different fusion tags (MBP, SUMO, Trx) known to enhance solubility

    • Try different expression vector systems with optimized promoters

    • Consider codon optimization for the expression host

  • Expression Conditions:

    • Reduce induction temperature (16-20°C)

    • Test various inducer concentrations

    • Supplement growth media with osmolytes or folding enhancers

    • Co-express with chaperones to promote proper folding

  • Solubilization Strategies:

    • Optimize extraction buffers with stabilizing agents (glycerol, specific detergents)

    • Test extraction under different pH conditions and ionic strengths

    • Include specific co-factors that might stabilize the protein structure

  • Activity Enhancement:

    • Add metal ions (Mn²⁺, Mg²⁺) required for catalytic activity

    • Include appropriate substrate concentrations to stabilize enzyme

    • Test activity in the presence of phospholipids or specific membrane components

    • Optimize buffer composition to mimic the Golgi environment

  • Alternative Approaches:

    • Express the protein in a eukaryotic system like baculovirus-insect cells, which has been successful for human B3GALT5

    • Consider membrane preparations instead of purified protein for activity assays

    • Explore cell-free expression systems that can accommodate membrane proteins

For storage and handling, maintain protein stability through lyophilization with protective agents like trehalose, mannitol, and Tween 80, similar to protocols used for human B3GALT5 .

How can I distinguish between the activities of different galactosyltransferases in Arabidopsis extracts?

Differentiating between various galactosyltransferase activities in complex Arabidopsis extracts requires strategic approaches to achieve specificity:

  • Substrate Selectivity:

    • Design assays using substrates that are preferentially acted upon by B3GALT5

    • Focus on acceptors requiring β1-3 galactose addition to terminal GlcNAc or GalNAc residues

    • Compare activity on globo- and lacto-series precursors versus other glycan types

  • Linkage Analysis:

    • Use linkage-specific glycosidases to distinguish between β1-3 and β1-4 galactose additions

    • Employ NMR spectroscopy to definitively determine glycosidic linkage types

    • Apply MS/MS fragmentation patterns to identify specific linkage signatures

  • Immunological Approaches:

    • Utilize antibodies specific to B3GALT5 for immunodepletion experiments

    • Perform activity assays before and after immunoprecipitation

    • Develop antibodies against unique epitopes of Arabidopsis B3GALT5

  • Genetic Tools:

    • Use extracts from B3GALT5 knockout lines as negative controls

    • Compare activities in extracts from plants overexpressing B3GALT5

    • Create a panel of different galactosyltransferase mutants for comparative analysis

  • Chromatographic Separation:

    • Fractionate plant extracts using ion exchange and other chromatographic methods

    • Test each fraction for specific galactosyltransferase activities

    • Correlate activity peaks with the presence of B3GALT5 (confirmed by Western blotting)

When analyzing results, consider that changes in one glycosyltransferase may affect the apparent activity of others through substrate competition or altered glycan profiles, similar to how B3GALT5 knockout in human cells led to compensatory increases in alternative glycan structures .

What are the critical controls needed when interpreting phenotypes of B3GALT5 mutant Arabidopsis lines?

When analyzing phenotypes of B3GALT5 mutant Arabidopsis lines, implement these essential controls to ensure robust and accurate interpretations:

  • Genetic Controls:

    • Multiple independent knockout/knockdown lines to rule out insertion site effects

    • Complementation lines expressing the wild-type B3GALT5 to confirm phenotype rescue

    • Tissue-specific or inducible B3GALT5 expression to pinpoint temporal/spatial requirements

    • Heterozygous plants to assess gene dosage effects

  • Biochemical Validation:

    • Comprehensive glycosphingolipid profiling to confirm the expected biochemical changes

    • Activity assays using plant extracts to verify loss of B3GALT5-specific galactosyltransferase activity

    • Analysis of compensatory changes in related glycosyltransferases (similar to human studies where B3GALT5 knockout led to upregulation of alternative pathways )

  • Phenotypic Assessment Controls:

    • Growth under various environmental conditions (temperature, light, humidity)

    • Assessment across multiple developmental stages

    • Stress response testing (drought, salt, pathogen challenge)

    • Quantitative measurements with appropriate statistical analysis

  • Potential Confounding Factors:

    • Monitor for changes in expression of other glycosyltransferases that might compensate for B3GALT5 loss

    • Check for alterations in ABA signaling components that might influence phenotypes

    • Assess broader metabolic changes that could occur secondary to glycolipid alterations

  • Experimental Design Considerations:

    • Include wild-type segregants from the same seed batch as controls

    • Grow mutant and control plants side by side under identical conditions

    • Blind scoring of phenotypes when possible

    • Use multiple experimental replicates with appropriate sample sizes

These controls help distinguish direct effects of B3GALT5 deficiency from indirect consequences or experimental artifacts, providing a more accurate understanding of the enzyme's biological functions.

What emerging technologies could advance our understanding of B3GALT5 function in Arabidopsis?

Several cutting-edge technologies offer promising avenues to deepen our understanding of B3GALT5 function in Arabidopsis:

  • Single-Cell Glycomics:

    • Apply single-cell MS techniques to analyze cell-specific glycan profiles

    • Combine with single-cell transcriptomics to correlate B3GALT5 expression with glycan changes

    • This approach could reveal cell-type specific functions, similar to how single-cell RNA-seq revealed B3GALT5 expression differences in human stem cell states

  • CRISPR-Based Technologies:

    • Implement base editing for precise modification of catalytic residues

    • Use CRISPRi/CRISPRa for temporal control of B3GALT5 expression

    • Apply CRISPR screens to identify genetic interactors of B3GALT5

  • Glycan Imaging Advancements:

    • Employ metabolic glycan labeling with bio-orthogonal chemistry for in vivo visualization

    • Use super-resolution microscopy to track B3GALT5-dependent glycan changes at subcellular resolution

    • Implement expansion microscopy for enhanced visualization of glycan distribution

  • Structural Biology Approaches:

    • Apply cryo-EM to determine B3GALT5 structure in complex with substrates

    • Use AlphaFold or similar AI platforms to predict structural features and substrate interactions

    • Perform molecular dynamics simulations to understand catalytic mechanisms

  • Synthetic Biology Tools:

    • Design synthetic glycosylation pathways to test B3GALT5 function in orthogonal systems

    • Create biosensors for real-time monitoring of B3GALT5 activity in vivo

    • Develop optogenetic control of B3GALT5 expression or localization

These technologies, particularly when combined in integrated approaches, could reveal previously hidden aspects of B3GALT5 function in plant development, stress responses, and cellular signaling pathways, potentially uncovering plant-specific roles distinct from its function in mammalian systems.

How might comparative studies between plant and human B3GALT5 advance glycobiology research?

Comparative studies between plant and human B3GALT5 offer unique opportunities to advance glycobiology across kingdoms:

  • Evolutionary Insights:

    • Trace the divergence of substrate specificities between plant and human B3GALT5

    • Identify conserved catalytic mechanisms versus organism-specific adaptations

    • Understand how glycosylation pathways evolved to serve different biological needs

  • Structure-Function Relationships:

    • Compare catalytic domains to identify critical residues for β1-3 galactosyltransferase activity

    • Examine differences in regulatory domains that might reflect distinct cellular contexts

    • Perform domain-swapping experiments to test functional conservation

  • Physiological Significance:

    • Compare the consequences of B3GALT5 deficiency across organisms

    • In humans, B3GALT5 knockout alters stem cell properties and glycosphingolipid profiles

    • Determine whether similar glycan-mediated mechanisms operate in plant development

  • Technological Crossover:

    • Apply methodologies developed for human glycobiology to plant systems

    • Test if plant-specific glycan recognition systems could have biomedical applications

    • Develop heterologous expression systems leveraging strengths of both plant and mammalian cells

  • Therapeutic Applications:

    • Explore plant B3GALT5 as an alternative enzyme source for glycoengineering applications

    • Investigate if plant-derived glycans have unique bioactivities in mammalian systems

    • Develop plant-based production systems for therapeutic glycoproteins

Comparative studies could particularly focus on how B3GALT5 interacts with developmental signaling pathways in both kingdoms—relating to abscisic acid signaling in plants and cellular differentiation pathways in mammals—to uncover fundamental principles in glycobiology that transcend kingdom boundaries.

What computational approaches can predict substrate specificity and function of Arabidopsis B3GALT5?

Advanced computational methods offer powerful approaches to predict Arabidopsis B3GALT5 substrate specificity and functions:

  • Homology Modeling and Molecular Docking:

    • Build 3D models based on crystallized galactosyltransferases

    • Dock potential substrates to predict binding affinities

    • Simulate enzyme-substrate interactions with molecular dynamics

    • Map conservation of binding site residues across species

  • Machine Learning Approaches:

    • Train algorithms on known galactosyltransferase-substrate pairs

    • Implement neural networks to predict substrate preferences

    • Use feature extraction to identify key determinants of specificity

    • Apply transfer learning from human B3GALT5 data to inform plant enzyme predictions

  • Network Analysis Tools:

    • Construct co-expression networks to identify functional associates

    • Perform pathway enrichment analysis to predict biological processes

    • Integrate transcriptomic data across developmental stages and stress conditions

    • Apply gene set enrichment analysis to connect with known biological functions

  • Evolutionary Analysis:

    • Conduct phylogenetic analysis of B3GALT family across plant species

    • Identify positively selected residues that might indicate functional specialization

    • Compare with animal B3GALT5 to identify plant-specific adaptations

    • Use ancestral sequence reconstruction to track evolutionary changes in function

  • Systems Biology Integration:

    • Create in silico models of Arabidopsis glycosylation pathways

    • Simulate the effects of B3GALT5 perturbation on glycan profiles

    • Integrate with metabolic models to predict broader biochemical consequences

    • Use multi-omics data integration to place B3GALT5 in broader biological context

These computational approaches can guide experimental design by generating testable hypotheses about substrate specificity, regulatory mechanisms, and biological functions of Arabidopsis B3GALT5, significantly accelerating research progress in plant glycobiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.