Recombinant Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 6 (B3GALT6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
GALT31A; B3GALT6; At1g32930; F9L11.10; Beta-1,6-galactosyltransferase GALT31A; Beta-1,3-galactosyltransferase 6; GT31 family galactosyltransferase 1; AtGALT31A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GALT31A
Target Protein Sequence
MGMGRYQKSATSGVSARWVFVLCISSFLLGVLVVNRLLASFETVDGIERASPEQNDQSRS LNPLVDCESKEGDILSRVSHTHDVIKTLDKTISSLEVELATARAARSDGRDGSPAVAKTV ADQSKIRPRMFFVMGIMTAFSSRKRRDSIRGTWLPKGDELKRLETEKGIIMRFVIGHSSS PGGVLDHTIEAEEEQHKDFFRLNHIEGYHELSSKTQIYFSSAVAKWDADFYIKVDDDVHV NLGMLGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIY AISKDLATYISVNRQLLHKYANEDVSLGSWFIGLDVEHIDDRSLCCGTPLDCEWKGQAGN PCAASFDWSCSGICKSVDRMLEVHQRCGEGDGAIWHSSF
Uniprot No.

Target Background

Function
Beta-galactosyltransferase involved in the elongation of β-1,6-linked galactan side chains on arabinogalactan proteins. It is essential for embryonic development beyond the globular stage. This enzyme is also involved in the biosynthesis of type II arabinogalactan, transferring galactose from UDP-galactose to various arabinogalactan-derived oligosaccharides. B3GALT6 forms a complex with GALT29A, synergistically enhancing galactose addition at O6 positions of both β-1,6- and β-1,3-linked galactan.
Gene References Into Functions
  1. AtGALT31A plays a critical role in embryonic development beyond the globular stage. PMID: 23837821
Database Links

KEGG: ath:AT1G32930

STRING: 3702.AT1G32930.1

UniGene: At.40035

Protein Families
Glycosyltransferase 31 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the primary cellular localization of Arabidopsis thaliana B3GALT6?

Similar to its human counterpart, Arabidopsis thaliana B3GALT6 predominantly localizes to the Golgi apparatus. This localization is critical for its function in glycosylation pathways. In human studies, researchers have confirmed this localization using immunofluorescence with anti-flag antibodies and co-localization with Golgi markers such as GOLPH4 . When investigating Arabidopsis B3GALT6, researchers should employ similar approaches including subcellular fractionation and co-localization studies with plant-specific Golgi markers to confirm proper localization within plant cells.

What is the primary enzymatic function of B3GALT6 in plants?

B3GALT6 in Arabidopsis thaliana likely functions as a galactosyltransferase involved in the synthesis of glycosaminoglycan (GAG) chains. Based on homology with human B3GALT6, it likely catalyzes the addition of galactose to growing polysaccharide chains . In human cells, B3GALT6 specifically catalyzes the addition of a third galactose to the second galactose of the GAG linker region . Research methodologies to confirm enzymatic activity in plant systems should include:

  • In vitro enzymatic assays using purified recombinant protein

  • Substrate specificity determination using various potential glycan acceptors

  • Kinetic analysis to determine Km and Vmax values for different substrates

What are the most effective expression systems for producing recombinant Arabidopsis thaliana B3GALT6?

When producing recombinant Arabidopsis thaliana B3GALT6, researchers should consider the following expression systems based on experimental objectives:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, rapid growth, simple protocolsLacks post-translational modifications, potential inclusion bodiesStructural studies, antibody production
Yeast (P. pastoris)Post-translational modifications, secretion capabilityLower yield than bacteria, longer growth timeFunctional studies requiring glycosylation
Plant-based (N. benthamiana)Native-like glycosylation, proper foldingLower yield, time-consumingIn planta functional studies, protein-protein interactions
Insect cellsComplex glycosylation, proper foldingExpensive, specialized equipment neededHigh-quality protein for crystallography, enzymatic assays

The methodology should be selected based on the specific research question. Drawing from human B3GALT6 studies, which successfully expressed the protein in HeLa cells for subcellular localization studies , researchers working with plant B3GALT6 should optimize codon usage for the selected expression system and include appropriate purification tags.

What are the recommended methods for analyzing B3GALT6 variants in Arabidopsis thaliana?

To analyze B3GALT6 variants in Arabidopsis thaliana, researchers should employ a multifaceted approach:

  • Genetic analysis: Use exome sequencing (ES) following protocols similar to those used in human studies, where variant filtering focuses on rare coding variants with frequency less than 0.0001 .

  • Functional validation: Express variants in appropriate systems to assess:

    • Subcellular localization (using confocal microscopy)

    • Protein expression levels (via Western blot)

    • Enzymatic activity (through in vitro galactosyltransferase assays)

  • Phenotypic assessment: Generate transgenic plants expressing the variants to evaluate phenotypic consequences, particularly focusing on cell wall composition and plant growth characteristics.

In human studies, researchers successfully used Western blot analysis to demonstrate that certain variants (like R295C) maintained normal protein size but showed increased expression, while other variants (like L170fs*268) produced elongated proteins with reduced expression . Similar approaches would be valuable for plant B3GALT6 variants.

How can researchers effectively study the dominant-negative effects of B3GALT6 variants in Arabidopsis?

Based on findings in human B3GALT6 research, certain frameshift mutations can produce elongated proteins that exert dominant-negative effects . To study potential dominant-negative effects of B3GALT6 variants in Arabidopsis thaliana, researchers should:

  • Generate transgenic plants: Create lines expressing both wild-type and variant B3GALT6 under native or inducible promoters.

  • Analyze protein-protein interactions: Use techniques such as:

    • Bimolecular fluorescence complementation (BiFC)

    • Co-immunoprecipitation (Co-IP)

    • Förster resonance energy transfer (FRET)

  • Assess competitive binding: Determine if variant proteins compete with wild-type proteins for:

    • Subcellular localization in the Golgi

    • Substrate binding

    • Interactions with other proteins in glycosylation pathways

  • Quantify cell wall composition changes: Analyze how the presence of variant proteins affects:

    • Glycan profiles using mass spectrometry

    • Polysaccharide abundance using specific antibodies

    • Mechanical properties of cell walls

Human studies found that the L170fs*268 variant maintained normal subcellular localization but likely exerted a dominant-negative effect by occupying the normal B3GALT6 position in the Golgi . A similar mechanism may exist in plants and should be investigated using the approaches outlined above.

What are the experimental approaches to investigate the role of B3GALT6 in plant cell wall synthesis?

To investigate B3GALT6's role in plant cell wall synthesis, researchers should implement:

  • Loss-of-function approaches:

    • CRISPR/Cas9-mediated gene editing to create knockout mutants

    • RNAi or artificial microRNA for knockdown studies

    • Chemical inhibition of enzyme activity

  • Gain-of-function approaches:

    • Overexpression of wild-type or engineered variants

    • Tissue-specific or inducible expression systems

  • Cell wall analysis techniques:

    • Comprehensive microarray polymer profiling (CoMPP)

    • Fourier transform infrared spectroscopy (FTIR)

    • Immunohistochemistry with glycan-specific antibodies

    • Monosaccharide composition analysis

  • Integration with -omics approaches:

    • Transcriptomics to identify co-regulated genes

    • Proteomics to identify interacting partners

    • Glycomics to characterize altered glycan profiles

How should researchers approach contradictory results when studying B3GALT6 function across different plant systems?

When encountering contradictory results in B3GALT6 research across different plant systems, researchers should:

  • Systematically evaluate experimental variables:

    • Expression levels (quantify via qRT-PCR and Western blot)

    • Developmental stages (conduct time-course experiments)

    • Growth conditions (standardize temperature, light, humidity)

    • Genetic backgrounds (use multiple ecotypes or cultivars)

  • Apply statistical approaches:

    • Meta-analysis of multiple experiments

    • Bayesian modeling to account for variable uncertainty

    • Principal component analysis to identify major sources of variation

  • Consider tissue-specific effects:

    • Compare results across different tissues and cell types

    • Use tissue-specific promoters for targeted expression

    • Employ laser capture microdissection for precise sampling

  • Explore potential redundancy:

    • Identify and characterize paralogs with similar functions

    • Generate multiple gene knockouts to address functional redundancy

    • Perform complementation tests across species

Human B3GALT6 research has demonstrated that the same gene can exhibit different inheritance patterns and phenotypic consequences depending on the specific variant and genetic background . This complexity is likely present in plant systems as well.

What are the recommended bioinformatic pipelines for analyzing B3GALT6 variants in Arabidopsis thaliana?

For comprehensive analysis of B3GALT6 variants in Arabidopsis thaliana, researchers should implement the following bioinformatic pipeline:

Analysis StepRecommended ToolsKey ParametersOutput
Sequence AlignmentMUSCLE, MAFFTGap penalty optimization for glycosyltransferase domainsMultiple sequence alignment of B3GALT6 orthologs
Variant CallingGATK, FreeBayesQuality score >30, depth >10xComprehensive variant list
Variant AnnotationSnpEff, ANNOVARGene model: TAIR10 or latestFunctional impact predictions
Structural ModelingSWISS-MODEL, AlphaFoldTemplate selection based on other glycosyltransferases3D structural models of wild-type and variant proteins
Evolutionary AnalysisPAML, HyPhySite-specific selection testsIdentification of conserved functional regions
Variant PrioritizationCustom pipeline based on conservation, structural impact, and in silico function predictionCombined score threshold >0.8Ranked list of variants for functional testing

This approach mirrors successful pipelines used in human B3GALT6 research, where exome sequencing followed by careful filtering for rare variants (<0.0001 frequency) successfully identified disease-causing mutations .

What are the most effective assays for measuring B3GALT6 enzymatic activity in plant systems?

To accurately measure B3GALT6 enzymatic activity in plant systems, researchers should consider these methodologies:

  • In vitro galactosyltransferase assays:

    • Substrate: Synthetic acceptor oligosaccharides or purified natural substrates

    • Donor: UDP-[14C]galactose or UDP-[3H]galactose

    • Detection: Scintillation counting, HPLC with radiodetection

  • Cell-free extract assays:

    • Preparation: Microsomal fractions from transgenic plants

    • Reaction conditions: Optimize buffer composition, pH, temperature, and metal ion requirements

    • Analysis: Glycan profiling by HPAEC-PAD or MS

  • In vivo labeling approaches:

    • Metabolic labeling with azido-modified sugars

    • Click chemistry for visualization

    • Fluorescence microscopy or flow cytometry analysis

  • Competitive inhibition assays:

    • Use structural analogs of UDP-galactose

    • Determine IC50 values for different inhibitors

    • Structure-activity relationship analysis

Research on human B3GALT6 has utilized subcellular localization studies to infer functional consequences of variants , suggesting that combining enzymatic assays with localization studies would provide comprehensive functional characterization.

How can researchers effectively characterize B3GALT6 protein-protein interactions in the glycosylation pathway?

To characterize B3GALT6 protein-protein interactions within the plant glycosylation pathway, researchers should employ:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tag: Use small epitope tags (FLAG, HA) to minimize interference

    • Controls: Include negative controls (GFP, unrelated proteins)

    • Analysis: Apply statistical methods to identify specific interactors

  • Proximity-dependent labeling approaches:

    • BioID or TurboID fusions to B3GALT6

    • In vivo biotinylation of proximal proteins

    • Streptavidin pulldown and MS identification

  • Protein complementation assays:

    • Split-ubiquitin yeast two-hybrid for membrane proteins

    • Bimolecular fluorescence complementation in planta

    • Split luciferase assays for quantitative measurements

  • Analysis of protein complexes:

    • Blue native PAGE to preserve native complexes

    • Size exclusion chromatography with multi-angle light scattering

    • Crosslinking mass spectrometry to map interaction interfaces

Human B3GALT6 studies have demonstrated the importance of proper subcellular localization for function , suggesting that B3GALT6 likely operates within a multi-protein complex in the Golgi apparatus. Similar complexes are expected in plant systems.

What are the primary challenges and future directions in Arabidopsis thaliana B3GALT6 research?

Based on current understanding, researchers should address these key challenges:

  • Functional conservation assessment: Determine the degree of functional conservation between plant and animal B3GALT6 through complementation studies across kingdoms.

  • Substrate specificity determination: Identify the precise glycan structures that serve as substrates for Arabidopsis B3GALT6 through comprehensive glycomics approaches.

  • Integration with cell wall research: Establish how B3GALT6 activity contributes to specific cell wall properties through mechanical testing and in situ imaging of modified glycans.

  • Cross-species comparative studies: Extend findings from Arabidopsis to crop species to understand potential agricultural applications.

Human B3GALT6 research has recently revealed unexpected inheritance patterns (dominant effects) for certain variants , suggesting that plant B3GALT6 may similarly harbor undiscovered complexity in its functional roles and genetic behaviors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.