Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 2 (KCO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. The default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPK2; KCO2; At5g46370; MPL12.17; Two-pore potassium channel 2; AtTPK2; Calcium-activated outward-rectifying potassium channel 2; AtKCO2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TPK2
Target Protein Sequence
MANDGNGDNNDDPLRQYLMNPRINPPPPSLLTLPENNDVTIPMPITPLELKNRLIFGSFV RSRKESSLPIDALSQNPSTSSSATTSFSDSTDLLLPLTEPNKPVRKSKPTINFHRSKTAP AMAAINNISHPNDPKTDQQSDSKTIVNQAVALLVVYLSLGVLIYWLNRDSYNVKQTHPVV DALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTYVLDLQENYML ETARNESLNLNDRDKVRSYIIDVKKGRMRIRLKVGLALGVVVLCLGFGVLIMHFVEKIGW LDSFYFSVMSVTTVGYGDRAFNTLAGRLLAAMWLLVSTLAVARAILFLAESRVDKRNRER AKKVLGESMSISQFLDADIDCNGCVSKAEFVIYKLKKMDKITEKDINPIGFQFDKLDRTN SGRITLLDLLESSTKDLPTATSI
Uniprot No.

Target Background

Function
This protein likely functions as a voltage-independent potassium-selective tonoplast ion channel.
Database Links

KEGG: ath:AT5G46370

STRING: 3702.AT5G46370.1

UniGene: At.28669

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, stems, leaves and flowers.

Q&A

What is the structural organization of Arabidopsis thaliana potassium channels in the TPK/KCO family?

Arabidopsis thaliana contains five tandem-pore domain potassium channels (TPK1-TPK5) and the related one-pore domain potassium channel, KCO3 . The TPK channels contain four transmembrane domains and two pore domains, while KCO3 lacks the first pore domain and the second transmembrane span compared to the TPKs . Most of these channels (except TPK4) have tandem EF-hand motifs in their cytosolic C-terminal domains that function as Ca²⁺-binding domains . Phylogenetically, TPK channels are divided into two subfamilies: TPK1 belongs to one subfamily, while TPK2, TPK3, TPK4, and TPK5 belong to the second subfamily .

What is the subcellular localization pattern of TPK2 and related potassium channels?

TPK2 and KCO3 are both localized to the tonoplast (vacuolar membrane) . This localization is critical for their physiological functions in regulating vacuolar K⁺ flux. While TPK1 is also found in the tonoplast, TPK4 is uniquely localized to the plasma membrane . The specific targeting mechanisms for these channels likely involve distinct signal sequences that direct them to their respective membrane destinations.

How are TPK/KCO potassium channels evolutionarily related to other potassium channels?

TPK channels are the plant counterparts of animal Tandem Pore (TWIK-like) channels . They were identified through in silico approaches using the Arabidopsis genome sequencing program . Chromosome segment duplication analysis in the Arabidopsis genome supports the hypothesis that TPK2, TPK3, TPK4, and TPK5 share a common ancestral origin . KCO3 was initially thought to be structurally similar to animal potassium inward rectifying channels, leading to its classification as a plant Kir-like channel, though this classification has been reconsidered as our understanding of these channels has evolved .

What are effective experimental approaches for studying TPK2/KCO channel function in heterologous systems?

Functional complementation in potassium uptake-deficient yeast strains (such as E. coli LB2003) represents a powerful approach for studying TPK/KCO channel function . In this system, channel activity can be assessed by the ability of transformed cells to grow in low-potassium media. For example, truncated forms of TPK2 without EF-hand domains were able to restore growth of LB2003 cells in media containing 15 mM KCl, indicating that these domains are not essential for channel function .

The experimental design should include:

  • Proper controls (empty vector, known functional K⁺ channel like KAT1)

  • Multiple potassium concentrations to assess channel efficiency

  • Growth assessment in both solid and liquid media

  • Randomization of samples to prevent systematic bias

How can researchers effectively design experiments to investigate calcium regulation of TPK/KCO channels?

To investigate calcium regulation of TPK/KCO channels, researchers should consider the following experimental design principles:

  • Mutational analysis of the EF-hand domains (as done with TPK2 where substitution of Ser for Cys384 increased Ca²⁺ binding to EF1)

  • Direct calcium binding assays to determine binding affinities and stoichiometry

  • Electrophysiological measurements (patch-clamp recordings) at varying calcium concentrations

  • Factor in potential experimental variables by implementing:

    • Complete block design for controlling unwanted variation

    • Replication to increase statistical power

    • Randomization within blocks to eliminate effects of lurking variables

What approaches can be used to study oligomerization of TPK2 and KCO3 channels?

To study oligomerization of TPK2 and KCO3 channels, researchers can employ:

  • Visualization techniques using GFP-tagged proteins (as was done with KCO3 to reveal stable homo-dimers in leaves)

  • Co-immunoprecipitation assays to detect protein-protein interactions

  • FRET/BRET analyses to investigate in vivo interactions

  • Size exclusion chromatography to determine the quaternary structure

  • Cross-linking experiments followed by Western blotting

When designing these experiments, researchers should implement:

  • Factorial experimental designs instead of one-factor-at-a-time methods

  • Proper controls for non-specific binding

  • Statistical validation through resampling-based procedures for unsupervised classification

How can researchers determine the ion selectivity and conductance properties of TPK2?

To determine ion selectivity and conductance properties of TPK2, researchers should consider:

  • Patch-clamp electrophysiology of isolated vacuoles expressing the channel

  • Bi-ionic potential measurements to calculate permeability ratios

  • Site-directed mutagenesis of key residues in the pore domains, followed by functional testing

  • Competition assays with various cations to determine selectivity profile

TPK1, for instance, exhibits strong selectivity for K⁺ over Na⁺ and its activity is independent of membrane voltage but dependent on cytosolic pH (maximum open probability at pH 6.7) . Similar methodologies could be applied to TPK2 to determine its unique functional characteristics.

What experimental approaches can reveal the physiological roles of TPK2 in planta?

To investigate the physiological roles of TPK2 in plants:

  • Generate and characterize knockout/knockdown mutants

  • Create overexpression lines and assess phenotypes under various conditions

  • Employ tissue-specific or inducible expression systems

  • Analyze transcriptional responses to various stresses

  • Measure ion fluxes in wild-type vs. mutant plants

Analysis should include:

  • Well-controlled drought experiments (as potassium channels may affect water relations)

  • Measurement of vacuolar ion concentrations

  • Assessment of growth parameters under various stress conditions

  • Statistical analysis using appropriate linear models with consideration of false discovery rates

How do the calcium-binding EF-hand domains regulate TPK2 channel activity?

The regulation of TPK2 by its EF-hand domains presents an intriguing research question. Although experimental data indicates that EF1 and EF2 are not required for TPK2-mediated K⁺ channel activity in heterologous systems , they may play important regulatory roles in planta.

Advanced investigations should include:

  • Structure-function analysis through systematic mutations of the EF-hand domains

  • Real-time measurements of channel activity coupled with controlled calcium fluctuations

  • Computational modeling of calcium binding and resultant conformational changes

  • Analysis of potential interactions with other calcium-binding proteins

  • Investigation of post-translational modifications that might affect calcium sensitivity

For example, substitution of Ser for Cys384 increased Ca²⁺ binding to EF1 in TPK2 , suggesting specific structural determinants of calcium affinity that could be further exploited.

What is the molecular basis for the differences in function between TPK2 and KCO3?

Despite their structural similarities and shared tonoplast localization, TPK2 appears to be a functional K⁺ channel while KCO3 has been suggested to lack ion transport activity . Understanding the molecular basis for this difference requires:

  • Domain-swapping experiments to identify critical regions for channel function

  • Detailed analysis of the pore domain structures

  • Investigation of potential regulatory partners that might differ between the two proteins

  • Analysis of subunit assembly and stoichiometry

Experiments with KCO3-TPK2 chimeras have revealed fundamental structures required for K⁺ channel function . The ability of a minimal KCO3 variant (KCO3M') to complement the growth defect of E. coli LB2003 suggests that the first TM, the last TM, and the pore region in KCO3 can assemble as a tetramer to form a functional K⁺ channel .

How do TPK/KCO channels interact with other signaling pathways in response to environmental stresses?

Understanding the integration of TPK/KCO channel function with other signaling networks requires:

  • Transcriptomic analysis of wild-type and channel mutants under various stress conditions

  • Proteomic identification of interacting partners

  • Investigation of potential crosstalk with hormonal pathways (ABA, auxin)

  • Analysis of post-translational modifications in response to stress

  • Examination of potential roles in drought response, as potassium channels can affect water relations

For experimental design:

  • Implement factorial designs to test multiple factors simultaneously

  • Ensure proper statistical power through adequate replication

  • Use appropriate statistical methods for high-dimensional data analysis

  • Consider potential batch effects and control for them through randomization and blocking

What emerging technologies could advance our understanding of TPK2/KCO channel dynamics?

Future research on TPK2/KCO channels could benefit from:

  • Cryo-EM structural studies to determine precise three-dimensional architecture

  • Single-molecule FRET to study conformational changes during gating

  • Optogenetic approaches to control channel activity with light

  • CRISPR-based genome editing for precise modification of endogenous channels

  • Advanced electrophysiological techniques coupled with fluorescent sensors to simultaneously monitor ion fluxes and calcium signals

Each of these approaches requires careful experimental design with appropriate controls, randomization, and statistical analysis as outlined in modern experimental design principles .

How might systems biology approaches help elucidate the broader roles of TPK2 in plant physiology?

Systems-level understanding of TPK2 function could be approached through:

  • Integration of transcriptomic, proteomic, and metabolomic data from wild-type and mutant plants

  • Network analysis to identify key interacting partners and pathways

  • Mathematical modeling of ion transport across the tonoplast

  • Genome-wide association studies to identify natural variation affecting channel function

  • Comparative analysis across multiple plant species to understand evolutionary conservation

When designing such complex omics experiments, researchers should:

  • Ensure proper randomization to eliminate effects of lurking variables

  • Use blocking designs to control identified sources of non-biological variation

  • Consider the advantages and limitations of sample pooling strategies

  • Apply appropriate statistical methods for multiple hypothesis testing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.