Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 5, chloroplastic (KCO5)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant KCO5 is produced in heterologous systems such as E. coli or yeast, enabling large-scale studies. Specifications from commercial suppliers include:

ParameterDetail
Expression HostE. coli (common), yeast, or mammalian cells
TagN-terminal His-tag
Purity≥90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose
ReconstitutionRecommended in deionized water with 50% glycerol for stability

Functional Characteristics

KCO5 functions as a calcium-activated, voltage-independent K⁺ channel. Key properties include:

  • Calcium Activation: Channel activity increases with elevated cytosolic Ca²⁺, though exact binding sites remain under study .

  • Rectification: Outward rectification under physiological K⁺ gradients .

  • pH Sensitivity: Cytoplasmic acidosis inhibits channel activity .

  • Homomeric Assembly: Forms functional homomeric channels in vivo, unlike other TPK/KCO family members .

Pharmacological Profile:

ModulatorEffect on KCO5Source
Extracellular Ca²⁺Blocks K⁺ conductance at high concentrations In vitro assays
Cytoplasmic H⁺Inhibits channel activity Yeast complementation

Role in Plant Physiology

KCO5 is implicated in:

  • Chloroplast Ion Homeostasis: Regulates K⁺ flux across chloroplast membranes, impacting photosynthesis and stomatal dynamics .

  • Vacuolar K⁺ Storage: Collaborates with other TPK channels (e.g., TPK1) to maintain vacuolar K⁺ pools .

Evolutionary Context

Phylogenetic analysis places KCO5 in a subfamily with TPK2, TPK3, and TPK5, suggesting gene duplication events in Arabidopsis . Unlike animal BK channels, KCO5 lacks voltage sensitivity but shares calcium-dependent gating .

Applications in Research

Recombinant KCO5 is utilized for:

  • Ion Channel Studies: Electrophysiological characterization (e.g., patch-clamp in Xenopus oocytes) .

  • Plant Stress Responses: Investigating K⁺ dynamics under abiotic stress (e.g., salinity, drought) .

  • Structural Biology: Cryo-EM studies to resolve calcium-binding domains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TPK5; KCO5; At4g01840; T7B11.10; Two-pore potassium channel 5; AtTPK5; Calcium-activated outward-rectifying potassium channel 5, chloroplastic; AtKCO5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-408
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TPK5
Target Protein Sequence
SSSSSASITIPRSISNTSFFHEISQERLLLHHQDLEQSVQDDKEDQDSDSDETNRFLSQT RPLHRSRTAPAMVIIKDLRTKPPETKKPSPVSKSIIRQAIFLLIVYLTLGVSIYSFNRDH YSGIETHPVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNY VLDLQESMILTGIQTRQHHQHHHHHRFSAKDYIIDFEKGRMRIRMKVCLALCVVVLCIGV GALVLHFVEELGFVDSVYLSVMSVTTVGYGDRAFKTLQGRLFAAVWLLVSTLAVARAFLY LAEARIDRRHRKAVKLALNREITVDDLLKADTYQHGFISKSEYIVLKLKEMGKITQKDID QVVIQFEKLDPNQIGKITLPDLLGDPL
Uniprot No.

Target Background

Function

Probable voltage-independent potassium-selective tonoplast ion channel.

Database Links

KEGG: ath:AT4G01840

STRING: 3702.AT4G01840.1

UniGene: At.585

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hydathodes and the vascular tissues of roots, stems, leaves and flowers.

Q&A

What is the structural organization of KCO5 and how does it compare to other potassium channels in Arabidopsis?

KCO5 likely shares structural similarities with KCO1, the first characterized outward rectifying K+ channel from Arabidopsis thaliana. Based on homology, KCO5 likely belongs to the "two-pore" K+ channel family that has been described in humans, yeast, and plants. The structure would typically include four putative transmembrane segments and tandem calcium-binding EF-hand motifs that are crucial for its function .

Unlike single-pore potassium channels, the two-pore architecture of KCO5 provides distinct functional properties that allow it to respond to specific cellular signals, particularly calcium concentration changes. The chloroplastic localization of KCO5, as indicated in product descriptions, suggests specialized adaptations for functioning within the chloroplast membrane environment .

How does calcium activation influence KCO5 channel function at the molecular level?

The calcium-activation mechanism of KCO5 likely mirrors that observed in related KCO family channels. In KCO1, activation is strongly dependent on cytosolic free calcium concentration ([Ca2+]cyt), with no detectable K+ currents when [Ca2+]cyt is below 150 nM . The calcium sensitivity is mediated through the EF-hand motifs that undergo conformational changes upon calcium binding.

The molecular pathway likely involves:

  • Calcium binding to EF-hand domains

  • Conformational change in the protein structure

  • Opening of the channel pore

  • Selective outward passage of K+ ions

This calcium-dependent activation provides a mechanism for coupling potassium flux to calcium signaling pathways within the chloroplast, potentially linking photosynthetic activity with ion homeostasis.

What evolutionary relationships exist between KCO5 and other potassium channels across plant species?

Evolutionary analysis of plant potassium channels reveals that the KCO family has undergone significant diversification. The two-pore K+ channels represent a distinct evolutionary branch that likely arose from gene duplication events. Comparative genomic approaches similar to those used in population genetics studies of Arabidopsis could be employed to trace the evolutionary history of KCO5 .

The presence of chloroplast-targeted potassium channels like KCO5 across different plant lineages suggests an important conserved function in photosynthetic organisms. Evolutionary adaptations in KCO5 might correlate with environmental adaptation patterns observed in broader Arabidopsis population studies, particularly in regions with varying light conditions or temperature stresses .

What expression systems are most effective for producing functional recombinant KCO5 protein?

Based on successful approaches with related potassium channels, several expression systems can be considered for KCO5:

  • Insect cell expression system: Baculovirus-infected insect cells (Spodoptera frugiperda) have proven effective for expressing functional KCO1 and would likely work for KCO5 as well . This system provides appropriate post-translational modifications and membrane insertion infrastructure.

  • Yeast expression systems: Systems like those used for AtKUP5 functional studies (trk1 trk2 mutants) could be adapted for KCO5 functional complementation assays .

  • Plant protoplast transient expression: For studies requiring a more native cellular environment, Arabidopsis protoplasts can be transfected with KCO5 expression constructs.

The choice of expression system should consider the specific experimental goals, whether structural studies, functional characterization, or protein-protein interaction analysis.

What electrophysiological approaches best characterize KCO5 channel properties?

Electrophysiological characterization of KCO5 requires techniques that can detect and measure calcium-dependent outward rectifying potassium currents:

  • Whole-cell patch-clamp measurements: Similar to those used for KCO1, applying depolarizing voltage pulses while controlling cytosolic calcium concentrations .

  • Calcium concentration series: Testing channel activity across a range of calcium concentrations (50-1000 nM) to establish the calcium activation profile.

  • Ion selectivity protocols: Using varying extracellular and intracellular ionic compositions to determine selectivity for K+ versus other cations.

A typical experimental protocol would include:

  • Cell preparation (from chosen expression system)

  • Establishment of whole-cell configuration

  • Application of voltage step protocols from -100 to +100 mV

  • Recording current responses at different calcium concentrations

  • Analysis of rectification properties, activation kinetics, and calcium dependency

How can researchers effectively analyze KCO5 localization within chloroplast membranes?

Given the chloroplastic localization of KCO5 , specialized techniques are needed to study its distribution and dynamics:

  • Confocal microscopy with fluorescent protein fusions: GFP-tagged KCO5 constructs can be used to visualize localization patterns within chloroplasts.

  • Immunogold electron microscopy: Using KCO5-specific antibodies for precise localization within chloroplast sub-compartments.

  • Chloroplast fractionation: Separation of thylakoid and envelope membranes followed by Western blotting to determine KCO5 distribution.

  • Super-resolution microscopy: Techniques like STORM or PALM can provide nanoscale resolution of KCO5 distribution patterns.

Each approach has specific sample preparation requirements and technical considerations, and combining multiple methods provides the most comprehensive picture of KCO5 localization.

How does KCO5 function integrate with photosynthetic processes in chloroplasts?

As a chloroplastic potassium channel, KCO5 likely plays critical roles in ion homeostasis that support photosynthetic function:

  • Thylakoid lumen acidification: K+ efflux through KCO5 may counterbalance H+ accumulation during photosynthetic electron transport, helping maintain optimal pH gradients.

  • Osmotic regulation: KCO5 could regulate chloroplast volume and thylakoid spacing in response to light conditions.

  • Calcium signaling integration: The calcium sensitivity of KCO5 could link calcium-mediated signaling pathways to photosynthetic regulation, similar to redox-regulated proteins in chloroplasts .

The potential connection between KCO5 and photosynthesis is supported by the observation that photosynthesis-related genes show adaptive expression patterns in Arabidopsis populations exposed to different environmental conditions .

What regulatory mechanisms control KCO5 expression and activity?

Multiple regulatory mechanisms likely influence KCO5 expression and activity:

  • Transcriptional regulation: Environmental factors such as light intensity, photoperiod, and temperature stress may modulate KCO5 gene expression, similar to adaptations observed in other Arabidopsis genes .

  • Post-translational modifications: Besides calcium binding, KCO5 may undergo phosphorylation, redox regulation (similar to PFK5 ), or other modifications that fine-tune its activity.

  • Protein-protein interactions: KCO5 may interact with regulatory proteins within the chloroplast, forming functional complexes that respond to specific physiological conditions.

  • Environmental adaptation: Population genomics studies in Arabidopsis have shown that genes involved in photosynthesis and stress responses undergo adaptation to local environments , suggesting KCO5 may similarly be subject to selection pressures.

What is the relationship between KCO5 and stress responses in Arabidopsis?

KCO5, as a chloroplastic ion channel, likely participates in stress response pathways:

  • Light stress adaptation: The channel may help adjust ionic conditions within chloroplasts during high light stress, when calcium signaling is activated.

  • Temperature stress responses: Population studies show Arabidopsis adaptations to extremely cold winters and short summers , and KCO5 may contribute to chloroplast function under these conditions.

  • Heavy metal stress: Arabidopsis populations exposed to heavy metals show adaptations affecting photosynthetic gene expression , suggesting a potential involvement of chloroplastic channels like KCO5 in heavy metal stress responses.

Experimental approaches to study these relationships might include comparing KCO5 expression and activity across Arabidopsis ecotypes from different environments, or analyzing stress responses in KCO5 mutant lines.

How do genetic variations in KCO5 correlate with environmental adaptations in Arabidopsis populations?

Investigating KCO5 genetic variations across Arabidopsis populations requires approaches similar to those used in broader population genomics studies:

  • SNP identification and analysis: Identifying single nucleotide polymorphisms in KCO5 across diverse Arabidopsis accessions, similar to the approach used in population history studies .

  • Quantitative trait locus (QTL) mapping: Determining if KCO5 variants associate with specific phenotypes, particularly those related to photosynthetic efficiency or stress tolerance .

  • Haplotype analysis: Analyzing the distribution of KCO5 haplotypes across different geographic regions and environmental conditions .

Population studies of Arabidopsis have revealed that genes related to photosynthesis show strong selection signals in specific environments . For example, coastal areas of Lake Michigan, urban areas near New York City, and arid areas of California showed strong selection for photosynthesis-related genes, suggesting KCO5 variants might also show adaptive patterns in these regions .

What are the potential interactions between KCO5 and the chloroplast redox regulatory network?

The chloroplast contains sophisticated redox regulatory networks that control protein activity, and KCO5 may be integrated into these systems:

  • Thioredoxin interactions: Chloroplastic proteins like PFK5 undergo redox regulation via thioredoxin (Trx) systems . KCO5 might similarly be regulated by Trx-f or other thioredoxin types.

  • Redox-sensitive domains: Analysis of the KCO5 sequence for redox-sensitive cysteine residues that could form regulatory disulfide bonds, similar to those in PFK5 (Cys152 and Cys157) .

  • Light/dark metabolism switching: KCO5 activity may participate in the switching between light and dark metabolism in chloroplasts, complementing the redox regulation of enzymes like PFK5 and FBPase .

Experimental approaches could include redox shift assays with thiol-modifying reagents, site-directed mutagenesis of potential redox-sensitive cysteines, and activity measurements under varying redox conditions.

How can structural modeling inform the design of specific modulators of KCO5 activity?

Advanced structural analysis techniques can guide the development of specific KCO5 modulators:

  • Homology modeling: Creating KCO5 structural models based on related proteins, similar to the approach used for AtKUP5 .

  • Docking simulations: Predicting the binding modes of potential modulators to KCO5, particularly at the calcium-binding sites or pore regions .

  • Molecular dynamics simulations: Investigating how calcium binding affects KCO5 conformational dynamics.

A methodological approach would include:

  • Building a homology model using templates like KCO1

  • Validating the model through energy minimization

  • Identifying potential binding pockets

  • Virtual screening of compound libraries

  • In silico testing of binding affinities

  • Experimental validation of top candidates

This approach could lead to the development of specific KCO5 modulators for both research tools and potential agricultural applications.

What are the main technical challenges in purifying functional KCO5 for biochemical studies?

Purifying membrane proteins like KCO5 presents several technical challenges:

  • Solubilization challenges: Selecting appropriate detergents and conditions that maintain KCO5 structural integrity during extraction from membranes.

  • Maintaining calcium sensitivity: Preserving the native calcium-responsive properties throughout purification.

  • Yield optimization: Developing expression systems that produce sufficient quantities for biochemical and structural studies.

A methodological approach would include:

  • Screening multiple detergents (DDM, LMNG, digitonin)

  • Testing various stabilizing additives

  • Implementing nanodiscs or other membrane mimetics

  • Using fluorescence-based stability assays to optimize conditions

  • Developing affinity purification strategies with minimal impact on function

How can researchers effectively measure calcium-dependent activity of KCO5 in isolated chloroplasts?

Studying KCO5 activity in its native chloroplast environment requires specialized techniques:

  • Chloroplast isolation protocols: Gentle isolation procedures to maintain functional integrity of chloroplast membranes.

  • Calcium monitoring: Using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to monitor chloroplast calcium levels.

  • Potassium flux measurements: Employing potassium-selective electrodes or fluorescent indicators to measure K+ movement.

  • Patch-clamp of chloroplast membranes: Specialized electrophysiological techniques adapted for studying channels in chloroplast membranes.

Each approach has specific technical considerations and can provide complementary information about KCO5 function in its native environment.

What emerging technologies could advance understanding of KCO5 function in planta?

Several cutting-edge approaches could transform KCO5 research:

  • CRISPR-Cas9 genome editing: Creating precise modifications in the KCO5 gene to study structure-function relationships in vivo.

  • Optogenetic tools: Developing light-controlled calcium release systems to study KCO5 activation dynamics in living cells.

  • Single-molecule imaging: Tracking individual KCO5 channels to understand their distribution and mobility within chloroplast membranes.

  • Cryo-electron microscopy: Pursuing high-resolution structural determination of KCO5 in different functional states.

These technologies would provide unprecedented insights into KCO5 function in its native cellular context.

How might KCO5 research contribute to improving photosynthetic efficiency in crops?

Understanding KCO5 function could contribute to agricultural applications:

Population genetics studies in Arabidopsis have demonstrated that photosynthesis-related genes show adaptation signals in specific environments , suggesting that optimizing KCO5 function could be part of a broader strategy to enhance photosynthetic performance in changing environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.