Recombinant Arabidopsis thaliana Probable calcium-activated outward-rectifying potassium channel 6 (KCO6)

Shipped with Ice Packs
In Stock

Description

Calcium-Dependent Activation

KCO6 is activated by cytosolic Ca²⁺, enabling K⁺ efflux to regulate membrane potential and ion homeostasis. This activity is critical for:

  • Chloroplast Function: Modulating proton motive force (pmf) partitioning between Δψ (electric gradient) and ΔpH (proton gradient) in thylakoid membranes .

  • Vacuolar Excitability: Collaborating with TPC1 and TPK1 channels to mediate Ca²⁺- and voltage-induced electrical signals in vacuoles .

Cellular Localization

  • Thylakoid Stromal Lamellae: Regulates photosynthesis-related ion fluxes .

  • Vacuolar Membrane: Facilitates K⁺ release during stomatal closure and seed germination .

Homomeric Channel Formation

KCO6 forms functional homomeric channels in vivo, as shown by fluorescence resonance energy transfer (FRET) and bimolecular fluorescence complementation assays. Unlike other TPK channels, it exhibits minimal heteromeric interactions due to tissue-specific expression patterns .

Electrophysiological Properties

  • Outward Rectification: Preferential K⁺ efflux under depolarizing conditions .

  • Calcium Sensitivity: Half-maximal activation at cytosolic Ca²⁺ concentrations of ~1 µM .

Phenotypic Impacts in Mutants

  • Δpmf Regulation: kat2 mutants show impaired K⁺ distribution in leaves, suggesting a role in phloem K⁺ loading .

  • Stress Responses: Proposed involvement in salt stress adaptation via vascular K⁺ redistribution .

Applications of Recombinant KCO6

The recombinant protein is utilized for:

  • Biophysical Studies: Structural analysis of calcium-dependent gating mechanisms .

  • Drug Discovery: Screening modulators of plant K⁺ channels using electrophysiological assays .

  • Antibody Production: Antigen for generating anti-KCO6 antibodies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPK3; KCO6; At4g18160; F15J5.130; Two-pore potassium channel 3; AtTPK3; Calcium-activated outward-rectifying potassium channel 6; AtKCO6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TPK3
Target Protein Sequence
MANEGSDPLLQYMISPRLKKPPQLLFPLPEDNEVAIPMPMTPSEFKERLIFGPFSCSPRD SSHFIDSMKQPSPSSSSTAVNNPFSDSSTLDPLLPPPPPQPEPWLSDQTSSHCQGHALHR SKTAPAMAVINDLHHPIRQKDPTETSRSVVRQAFALLVVYLSLGVLIYWLNRDHYVVNQT HPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGMVSYVLDLQE SYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCIAVGVGIMHFIEEIGW LDSFYLSVMSVTTVGYGDRAFKTLPGRLFAAIWLLVSTLAVARAFLYLAEARVDKRNRER AKKVLCETMSVSQFFAADIDNNGCVSKAEYVIYKLKEMEKITDKDILPISKQFDKLDRCS NGKITLLDLLEGGSGD
Uniprot No.

Target Background

Function
The two-pore potassium channel regulates the proton motive force (pmf), which is essential for converting photochemical energy into physiological functions. It facilitates potassium efflux from the thylakoid lumen. This efflux plays a crucial role in regulating the transmembrane electrical potential, enhancing the pH gradient for ATP synthesis, regulating electron flow, and mediating pH-dependent photoprotective responses. The channel requires calcium for its activity.
Gene References Into Functions
  1. KCO6 does not form functional potassium channels when expressed in E. coli PMID: 23656881
  2. The TPK3 channel manages the proton motive force required to convert photochemical energy into physiological functions. PMID: 24009357
Database Links

KEGG: ath:AT4G18160

STRING: 3702.AT4G18160.1

UniGene: At.32938

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=PubMed:24009357 shows a thylakoid location instead of the tonoplast location previously described.
Tissue Specificity
Expressed in roots, stems, hypocotyls, leaves and flowers. Detected in root tips and in mesophyll cells and guard cells of the leaves.

Q&A

What is Arabidopsis thaliana and why is it used as a model organism for studying potassium channels?

Arabidopsis thaliana is a simple angiosperm plant, vascular and dicotyledonous, belonging to the Brassicaceae family. Native to Eurasia and North Africa, it has become widely distributed throughout the northern hemisphere. Despite its unassuming appearance with small leaves in a basal rosette arrangement and simple stem, A. thaliana has become the most important model plant in biological research .

Several characteristics make A. thaliana ideal for studying potassium channels:

  • Small genome size that has been fully sequenced

  • Short life cycle (approximately 6 weeks from germination to mature seed)

  • High fecundity (producing thousands of seeds per plant)

  • Ease of transformation for genetic studies

  • Extensive genetic resources, including mutant lines and mapping populations

These advantages facilitate detailed investigation of potassium channels like KCO6, enabling researchers to understand their structure, function, and regulation in plant systems.

How does KCO6 relate to other potassium channels in the Arabidopsis genome?

KCO6 belongs to the family of calcium-activated outward-rectifying potassium channels in Arabidopsis thaliana. The first characterized member of this family was KCO1, which features four putative transmembrane segments and tandem calcium-binding EF-hand motifs .

KCO6 shares structural similarities with KCO1, including:

  • Membership in the "two-pore" K+ channel class also found in humans and yeast

  • Calcium-dependent activation mechanism

  • Outward rectification properties (facilitating K+ efflux from cells)

  • Presence of EF-hand motifs for calcium binding

Unlike many other ion channels that have six transmembrane domains, the KCO family typically has four transmembrane segments, making them structurally distinct within the larger potassium channel superfamily.

What are the functional roles of calcium-activated potassium channels in plant physiology?

Calcium-activated potassium channels like KCO6 play crucial roles in multiple physiological processes:

  • Signal Transduction: These channels provide a direct link between calcium-mediated signaling processes and potassium ion transport , integrating multiple cellular signals.

  • Osmoregulation: By controlling K+ efflux, they help regulate cell turgor and volume during environmental stress responses.

  • Membrane Potential Regulation: Activation leads to potassium efflux, causing membrane hyperpolarization that influences other voltage-dependent transporters.

  • Stomatal Movement: K+ flux is essential for stomatal opening and closing, regulating gas exchange and water loss.

  • Stress Responses: These channels participate in responses to various stresses including drought, salinity, and pathogen attack.

The calcium dependency of channels like KCO6 allows plants to coordinate potassium transport with calcium-based signaling cascades that respond to environmental and developmental cues.

What are the most effective systems for heterologous expression of recombinant KCO6?

For functional expression and characterization of recombinant KCO6, several expression systems have proven effective, similar to those used for related potassium channels:

Insect Cell Expression System:

  • Baculovirus-infected insect cells (e.g., Spodoptera frugiperda) provide an excellent platform for functional expression

  • Advantages include proper protein folding, post-translational modifications, and high expression levels

  • Protocol includes cloning KCO6 cDNA into a baculovirus transfer vector, generating recombinant baculovirus, and infecting insect cells

Xenopus Oocyte Expression:

  • Allows for electrophysiological characterization through injection of in vitro transcribed KCO6 RNA

  • Expression typically detectable 2-5 days post-injection

  • Well-suited for two-electrode voltage clamp recordings

Yeast Expression Systems:

  • Particularly useful for complementation studies in K+ transport-deficient yeast strains

  • Enables functional characterization through growth assays on media with varying K+ concentrations

Each system has specific advantages depending on experimental goals, with insect cells providing the best platform for detailed biophysical characterization, as demonstrated with related channels .

What electrophysiological techniques are most suitable for characterizing KCO6 channel activity?

The following electrophysiological techniques are most suitable for characterizing KCO6 channel activity:

Whole-Cell Patch Clamp:

  • Allows measurement of macroscopic currents across the entire cell membrane

  • Ideal for determining activation kinetics, voltage dependence, and calcium sensitivity

  • Essential for observing outwardly rectifying K+-selective currents elicited by depolarizing voltage pulses

  • Enables manipulation of cytosolic free Ca2+ concentration to establish calcium dependency

Single-Channel Analysis:

  • Performed on excised membrane patches (inside-out configuration preferred for controlling Ca2+ exposure)

  • Permits determination of single channel conductance (expected to be similar to the 64 pS measured for KCO1)

  • Allows detailed characterization of channel gating properties and open probability as a function of calcium concentration

Experimental Conditions for Optimal Characterization:

ParameterRecommended RangeNotes
Cytosolic Ca2+150-500 nMExpected activation threshold ~150 nM; saturation ~300 nM
Holding Potential-60 to -80 mVFor establishing baseline
Test Potentials-100 to +100 mVIn 20 mV increments to characterize voltage dependence
External K+30-150 mMFor conductance and selectivity measurements
Internal K+100-150 mMFor physiological relevance
Recording Temperature20-22°CFor stability and reproducibility

These approaches, combined with appropriate pharmacological tools, enable comprehensive functional characterization of KCO6.

How can researchers verify the calcium sensitivity of recombinant KCO6?

Verifying calcium sensitivity of recombinant KCO6 requires rigorous experimental approaches similar to those used for KCO1:

Patch Clamp with Controlled Calcium Buffers:

  • Prepare internal solutions with precisely calculated free Ca2+ concentrations using calcium chelators (EGTA or BAPTA)

  • Test multiple Ca2+ concentrations (e.g., <150 nM, 200 nM, 300 nM, 500 nM, 1 μM)

  • Measure channel activity at each concentration to establish activation threshold and saturation point

  • Expect minimal activity at <150 nM Ca2+ and saturating activity around 300 nM, similar to KCO1

Calcium Imaging Combined with Electrophysiology:

  • Load cells with ratiometric calcium indicators (Fura-2 or Indo-1)

  • Simultaneously monitor calcium levels and channel activity

  • Use calcium ionophores (ionomycin) or calcium-mobilizing agents to manipulate intracellular calcium

Mutagenesis of Calcium-Binding Domains:

  • Identify putative EF-hand motifs through sequence analysis

  • Generate point mutations in key calcium-coordinating residues

  • Express mutant channels and test for altered calcium sensitivity

  • Compare activation thresholds and dose-response curves between wild-type and mutant channels

Data should be presented as a dose-response curve plotting channel activity against log[Ca2+], with statistical analysis to determine EC50 values and Hill coefficients, providing quantitative measures of calcium sensitivity.

What are the most efficient strategies for generating KCO6 knockout or overexpression lines in Arabidopsis?

For KCO6 Knockout Lines:

  • T-DNA Insertion Lines:

    • Screen existing collections from repositories like the Arabidopsis Biological Resource Center (ABRC)

    • Potential lines can be identified based on existing T-DNA insertions in publicly available databases

    • Verify knockouts through PCR genotyping and RT-PCR for expression analysis

    • Backcross to wild-type to remove potential secondary mutations

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs targeting exonic regions of KCO6

    • Use Agrobacterium-mediated transformation with constructs containing Cas9 and guide RNAs

    • Screen transformants for mutations using sequencing

    • Select and propagate lines with frameshift mutations that disrupt protein function

For KCO6 Overexpression Lines:

  • Constitutive Overexpression:

    • Clone KCO6 coding sequence into vectors with strong constitutive promoters (35S CaMV)

    • Transform Arabidopsis using floral dip method

    • Select transformants and verify expression levels through qRT-PCR

    • Establish homozygous lines through segregation analysis

  • Inducible Expression Systems:

    • Utilize steroid-inducible promoters similar to those used for MAPKK expression

    • This allows temporal control of expression, avoiding potential developmental defects

    • Verify induction through time-course expression analysis following application of inducers like dexamethasone

  • Tissue-Specific Expression:

    • Use tissue-specific promoters to target expression to relevant tissues

    • Particularly useful if constitutive expression causes severe phenotypes

All generated lines should be validated for proper expression levels and functional impacts through electrophysiological measurements of K+ fluxes in the appropriate tissues.

How can researchers identify and analyze potential QTLs associated with KCO6 function?

Identifying QTLs associated with KCO6 function requires systematic genetic approaches:

QTL Mapping Strategy:

  • Population Development:

    • Use Advanced Intercross Recombinant Inbred Lines (AI-RILs) to increase mapping resolution

    • Cross accessions with different KCO6 activity or related phenotypes

    • Design should achieve high density of recombination events (ideally 50 kb/cM)

  • Phenotyping Approach:

    • Develop quantitative assays for KCO6-related traits

    • Measure physiological parameters like K+ content, stress responses, or electrophysiological characteristics

    • Ensure high-throughput capability for large population screening

  • Genotyping Methods:

    • Utilize SNP markers with average intermarker distance of approximately 600 kb

    • Consider whole-genome sequencing for more precise genotyping

    • Apply statistical methods to detect segregation distortion that might affect mapping

  • QTL Analysis:

    • Apply composite interval mapping to identify QTL positions

    • Use multiple-QTL models to account for epistatic interactions

    • Calculate LOD scores and determine significance thresholds through permutation tests

  • Fine Mapping:

    • Develop Near Isogenic Lines (NILs) for significant QTLs

    • Use additional markers within QTL regions

    • Narrow candidate regions to manageable intervals for gene identification

Data Analysis and Interpretation:

  • Implement MapMan or similar pathway analysis tools to integrate genotypic and phenotypic data

  • Consider potential epistatic interactions between KCO6 and other loci

  • Validate findings through complementation tests with cloned KCO6 variants

This approach allows researchers to identify genetic factors that modify KCO6 function or its physiological impacts across different Arabidopsis accessions.

What techniques are most effective for studying KCO6 protein-protein interactions?

Understanding KCO6 protein interactions requires multiple complementary approaches:

In Vivo Techniques:

  • Split-Ubiquitin Yeast Two-Hybrid:

    • Particularly suitable for membrane proteins like KCO6

    • Fusion of KCO6 with C-terminal ubiquitin fragment as bait

    • Screen against Arabidopsis cDNA libraries fused to N-terminal ubiquitin fragment

    • Positive interactions reconstitute ubiquitin, releasing transcription factor for reporter gene activation

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein approach with KCO6 fused to one fragment

    • Co-expression with potential interactors fused to complementary fragment

    • Fluorescence indicates protein proximity in plant cells

    • Allows subcellular localization of interaction sites

  • Co-Immunoprecipitation (Co-IP):

    • Express epitope-tagged KCO6 in Arabidopsis

    • Immunoprecipitate protein complexes using antibodies against tag

    • Identify interacting partners through mass spectrometry

    • Verify with reciprocal Co-IP experiments

In Vitro Methods:

  • Pull-Down Assays:

    • Express recombinant KCO6 fragments as fusion proteins

    • Use as bait with plant extracts to capture interacting partners

    • Particularly useful for domain-specific interaction mapping

  • Surface Plasmon Resonance (SPR):

    • Measures real-time binding kinetics between KCO6 and potential partners

    • Provides quantitative data on association/dissociation rates

    • Requires purified recombinant proteins

Data Validation and Analysis:

Validation ApproachPurposeConsiderations
Domain MappingIdentify specific interaction regionsTest truncated versions of KCO6
Competition AssaysConfirm specificity of interactionsUse excess unlabeled protein
Functional AssaysDetermine physiological relevanceMeasure channel activity changes
ColocalizationVerify spatial proximityUse confocal microscopy

The combination of these approaches provides a comprehensive view of KCO6 interaction partners and their functional significance.

How does cytosolic calcium concentration affect KCO6 gating kinetics and conductance properties?

Based on studies of related channels like KCO1, the relationship between cytosolic calcium and KCO6 function can be characterized as follows:

Calcium Concentration Effects on Channel Gating:

  • Activation Threshold:

    • KCO6 channels likely remain closed at resting cytosolic calcium levels (<150 nM)

    • Initial activation occurs when calcium rises above this threshold

    • Full characterization requires establishing precise threshold values specific to KCO6

  • Calcium-Dependent Gating Kinetics:

    • Increasing [Ca2+]cyt accelerates activation kinetics

    • At intermediate calcium levels, activation may show delayed components

    • At saturating calcium concentrations (~300 nM), activation becomes rapid and complete

  • Dose-Response Relationship:

    • Expected sigmoidal relationship between calcium concentration and channel activation

    • Hill coefficient analysis can reveal cooperativity in calcium binding

    • EC50 value provides quantitative measure of calcium sensitivity

Conductance Properties:

  • Single Channel Conductance:

    • Based on related channels, KCO6 likely exhibits a single channel conductance of approximately 60-70 pS in physiological K+ concentrations

    • Conductance may show subtle calcium-dependent modulation

  • Voltage-Dependent Properties:

    • Outward rectification becomes more pronounced at higher calcium concentrations

    • Current-voltage relationships shift based on calcium concentration

    • Activation voltages may decrease as calcium concentration increases

Physiological Implications:

[Ca2+]cyt Range (nM)Expected Channel BehaviorPhysiological Context
<150Minimal activityResting conditions
150-250Intermediate activationModerate signaling events
>300Maximal activationStress responses, signaling peaks

These calcium-dependent properties allow KCO6 to function as a coincidence detector, integrating both calcium signaling and membrane potential to regulate potassium efflux in response to specific cellular conditions.

What roles does KCO6 play in plant responses to environmental stresses?

KCO6, as a calcium-activated potassium channel, likely contributes significantly to various stress responses in Arabidopsis:

Drought and Osmotic Stress:

  • Stomatal Regulation:

    • Contributes to K+ efflux from guard cells during stomatal closure

    • Activation occurs downstream of ABA-induced calcium oscillations

    • Helps reduce water loss during drought conditions

  • Osmotic Adjustment:

    • Facilitates K+ redistribution between cellular compartments

    • May coordinate with other transporters to maintain cell volume

    • Influences compatible solute accumulation under water deficit

Salt Stress Response:

  • Na+/K+ Homeostasis:

    • Assists in maintaining optimal K+/Na+ ratios during salt stress

    • Works in concert with Na+ exclusion mechanisms

    • Contributes to salt tolerance by preventing excessive K+ loss

  • Membrane Potential Regulation:

    • Helps restore membrane potential after salt-induced depolarization

    • Influences the driving force for other ion transporters

Pathogen Response:

  • Immune Signaling:

    • May participate in calcium-dependent signal transduction during pathogen recognition

    • Potentially works downstream of MAPK cascades similar to those regulating MMPs

    • Contributes to ion fluxes associated with hypersensitive response

  • Cell Death Regulation:

    • K+ efflux is associated with programmed cell death during pathogen responses

    • KCO6 may facilitate this efflux following calcium elevation during immune responses

Temperature Stress:

  • Cold Acclimation:

    • Cold stress induces calcium signatures that could activate KCO6

    • Channel activation may contribute to membrane stabilization during temperature shifts

  • Heat Stress:

    • Calcium transients during heat stress could trigger KCO6-mediated responses

    • May participate in metabolic adjustments to high temperature

Understanding these roles requires integrating KCO6 function with broader signaling networks, including MAPK cascades that have been implicated in various stress responses in Arabidopsis .

How can comparative genomics approaches enhance our understanding of KCO6 evolution and function across plant species?

Comparative genomics provides valuable insights into KCO6 evolution and functional conservation:

Evolutionary Analysis Approaches:

  • Phylogenetic Reconstruction:

    • Identify KCO6 orthologs across diverse plant lineages

    • Construct robust phylogenetic trees using maximum likelihood or Bayesian methods

    • Map gene duplication and loss events throughout plant evolution

    • Correlate evolutionary patterns with habitat adaptation and stress tolerance

  • Synteny Analysis:

    • Examine conservation of genomic regions surrounding KCO6

    • Identify collinear blocks containing KCO6 orthologs

    • Determine if KCO6 resides in rapidly or slowly evolving genomic regions

  • Selection Pressure Analysis:

    • Calculate Ka/Ks ratios to detect positive or purifying selection

    • Identify specific amino acid residues under selection

    • Compare selection patterns between calcium-binding domains, pore regions, and regulatory domains

Functional Conservation Assessment:

  • Domain Architecture Comparison:

    • Analyze conservation of key functional domains (EF hands, pore regions, transmembrane segments)

    • Identify species-specific modifications that might alter channel properties

    • Map conservation onto predicted structural models

  • Expression Pattern Comparison:

    • Use tools similar to MapMan to compare expression patterns across species

    • Analyze conservation of cis-regulatory elements in promoter regions

    • Determine if expression responds to similar environmental cues across species

Experimental Approaches Using Comparative Data:

ApproachMethodologyExpected Insights
Heterologous ComplementationExpress KCO6 orthologs in Arabidopsis kco6 mutantsFunctional conservation across species
Domain SwappingCreate chimeric channels with domains from different speciesIdentify domains responsible for species-specific properties
Promoter AnalysisTest promoters from different species in ArabidopsisConservation of regulatory mechanisms
Cross-Species QTL AnalysisCompare QTLs affecting K+ homeostasis across speciesShared genetic architecture of K+ regulation

These comparative approaches can reveal how KCO6 function has been conserved or diversified throughout plant evolution, providing insights into its fundamental roles and adaptations to different ecological niches.

How might single-cell transcriptomics advance our understanding of cell-specific KCO6 expression patterns?

Single-cell transcriptomics offers unprecedented resolution for understanding KCO6 expression:

Methodological Approaches:

  • Tissue Preparation and Cell Isolation:

    • Protoplast isolation from specific Arabidopsis tissues

    • Fluorescence-activated cell sorting (FACS) for enrichment of specific cell types

    • Microfluidic-based cell capture for sensitive detection of low-abundance transcripts

  • Single-Cell RNA-Seq Platforms:

    • Droplet-based approaches (10x Genomics)

    • Plate-based methods with full-length transcript detection (Smart-seq2)

    • Spatial transcriptomics to maintain tissue context information

  • Data Analysis Pipeline:

    • Quality control and normalization of single-cell data

    • Dimensionality reduction and clustering to identify cell types

    • Trajectory inference to map developmental progressions

    • Integration with existing Arabidopsis cell atlases

Expected Insights:

  • Cell Type-Specific Expression Patterns:

    • Identification of cell types with highest KCO6 expression

    • Discovery of previously unknown expression domains

    • Correlation with other ion channels and transporters

  • Developmental Regulation:

    • Changes in expression across developmental stages

    • Identification of transcription factors co-expressed with KCO6

    • Temporal coordination with calcium signaling components

  • Stress-Responsive Expression:

    • Cell-specific responses to environmental stresses

    • Heterogeneity in expression patterns within the same tissue

    • Identification of stress-responsive cell populations

Integration with Functional Studies:

  • Gene Regulatory Network Reconstruction:

    • Inference of transcription factors controlling KCO6 expression

    • Integration with pathway analysis tools like MapMan

    • Identification of co-expression modules

  • Cell Type-Specific Functional Validation:

    • Design of cell type-specific promoters for targeted KCO6 manipulation

    • Electrophysiological characterization in identified cell types

    • Correlation of expression patterns with cellular calcium dynamics

This approach will transform our understanding of KCO6 biology by moving beyond tissue-level observations to reveal cell-specific expression patterns and regulatory mechanisms.

What are the challenges and solutions in developing KCO6-specific pharmacological modulators?

Developing specific modulators for plant ion channels like KCO6 presents unique challenges:

Major Challenges:

  • Structural Characterization Limitations:

    • Limited availability of high-resolution structures for plant ion channels

    • Challenges in membrane protein crystallization or cryo-EM analysis

    • Reliance on homology modeling with limited sequence identity to mammalian channels

  • Selectivity Issues:

    • Potential cross-reactivity with other plant potassium channels

    • Possible off-target effects on calcium signaling pathways

    • Maintaining specificity while achieving sufficient potency

  • Delivery Challenges:

    • Cell wall barrier limiting compound access

    • Variable compound stability in plant tissues

    • Achieving adequate concentration at target sites

Strategic Solutions:

  • Structure-Based Approaches:

    • Develop homology models based on related channels with known structures

    • Focus on unique features of KCO6, particularly calcium-binding domains

    • Use molecular dynamics simulations to identify potential binding pockets

    • Employ virtual screening against these pockets

  • High-Throughput Screening Methods:

    • Develop yeast-based screening systems expressing KCO6

    • Use electrophysiological platforms for direct activity measurement

    • Implement fluorescence-based assays for calcium and potassium flux

  • Chemical Libraries and Design:

    • Screen natural product libraries, particularly plant-derived compounds

    • Focus on molecules with physicochemical properties suitable for plant cell entry

    • Design compounds targeting the interface between calcium-binding and gating domains

Validation Approaches:

Validation StepMethodologyPurpose
In Vitro ActivityPatch-clamp in heterologous systemsConfirm direct effects on channel activity
Selectivity ProfilingTesting against panel of related channelsEstablish KCO6 specificity
In Planta EfficacyPhysiological assays in ArabidopsisVerify activity in native environment
Target EngagementThermal shift assays or photoaffinity labelingConfirm physical interaction with KCO6

Successful development of KCO6-specific modulators would provide valuable research tools for dissecting channel function and potentially lead to applications in agriculture for enhancing stress resilience.

How might CRISPR base editing technologies advance functional studies of KCO6 calcium-binding domains?

CRISPR base editing offers precise approaches for studying KCO6 structure-function relationships:

Technological Advantages for KCO6 Studies:

  • Precision Editing Capabilities:

    • Cytosine base editors (CBEs) enable C→T conversions

    • Adenine base editors (ABEs) facilitate A→G changes

    • Prime editing allows for small insertions, deletions, and all possible base substitutions

    • These tools permit single amino acid changes without double-strand breaks

  • Targeted Modification Strategies:

    • Single nucleotide changes to modify key calcium-coordinating residues in EF-hand motifs

    • Sequential editing to create allelic series with varying calcium sensitivity

    • Introduction of subtle mutations that maintain protein expression and folding

  • Applications for KCO6 Functional Domains:

    • Modify calcium-binding affinity through targeted mutations of EF-hand motifs

    • Alter selectivity filter residues to change ion selectivity

    • Introduce changes to transmembrane regions to affect gating properties

Experimental Design Approach:

  • Target Site Selection:

    • Identify conserved calcium-coordinating residues through alignment with related channels

    • Prioritize negatively charged residues (D, E) in EF-hand loops

    • Design guide RNAs with optimal PAM sites and editing windows

  • Editing Strategy Implementation:

    • Design and construct appropriate base editor vectors

    • Transform Arabidopsis through established methods

    • Screen transformants using targeted sequencing

    • Confirm editing precision and absence of off-target effects

  • Functional Characterization Pipeline:

    • Establish electrophysiological protocols to assess calcium sensitivity, similar to those used for KCO1

    • Develop calcium dose-response curves for each edited variant

    • Compare activation thresholds, EC50 values, and maximal activation levels

Expected Outcomes and Applications:

Editing TargetMutation TypeExpected Functional ImpactResearch Application
EF-hand loop positions 1,3,5,12Conservative substitutionsAltered calcium affinityStructure-function relationship
Pore region residuesSubtle modificationsChanged conductance or selectivityIon permeation mechanisms
TMD-EF-hand interfacesInterface residue changesModified coupling efficiencyCalcium-gating relationship

This approach allows unprecedented precision in studying structure-function relationships in KCO6, potentially revealing key residues that determine calcium sensitivity, activation kinetics, and channel gating.

What strategies can researchers employ when KCO6 shows poor expression or functionality in heterologous systems?

When faced with poor expression or functionality of recombinant KCO6, researchers can implement several targeted strategies:

Expression Optimization Approaches:

  • Vector and Promoter Selection:

    • Test multiple expression vectors with different promoter strengths

    • Consider using plant-optimized promoters even in heterologous systems

    • Implement inducible expression systems to minimize potential toxicity

  • Codon Optimization:

    • Analyze KCO6 coding sequence for rare codons in the expression host

    • Implement codon optimization based on host codon usage bias

    • Balance GC content and avoid rare codon clusters

  • Fusion Tags and Trafficking Signals:

    • Test various affinity tags (His, FLAG, GST) at N or C terminus

    • Include appropriate trafficking signals for membrane localization

    • Consider signal sequence modifications to improve membrane targeting

Functional Enhancement Strategies:

  • Expression of Auxiliary Subunits:

    • Co-express potential regulatory partners or chaperones

    • Include calcium-sensing proteins that might enhance function

    • Test with known interacting proteins from Arabidopsis

  • Membrane Composition Modification:

    • Supplement expression systems with plant-specific lipids

    • Consider cholesterol depletion or enrichment depending on the system

    • Test effects of phosphoinositides that might regulate channel function

  • Post-Translational Modification Considerations:

    • Assess potential glycosylation or phosphorylation requirements

    • Expression in systems capable of plant-like modifications

    • Site-directed mutagenesis of potential modification sites

Troubleshooting Decision Tree:

ProblemDiagnostic ApproachSolution Strategy
No protein expressionWestern blot analysisTry different promoters, codon optimization
Protein expressed but not at membraneImmunofluorescence localizationAdd trafficking signals, optimize signal sequence
Membrane expression but no functionSurface biotinylation + electrophysiologyTest different recording conditions, co-express partners
Poor folding/aggregationDetergent solubility screeningLower expression temperature, add molecular chaperones

Systematic application of these approaches can overcome common challenges in heterologous expression of plant ion channels like KCO6.

How can researchers address data inconsistencies between in vitro and in planta studies of KCO6 function?

Reconciling discrepancies between in vitro and in planta observations requires systematic investigation:

Sources of Potential Inconsistencies:

  • Protein Environment Differences:

    • Membrane composition variations between expression systems and plant cells

    • Absence of plant-specific regulatory partners in heterologous systems

    • Different post-translational modifications affecting channel properties

  • Experimental Condition Disparities:

    • Non-physiological ion concentrations in electrophysiological studies

    • Temperature differences between recording conditions and plant growth environments

    • Acute vs. chronic calcium exposure patterns

  • Methodological Limitations:

    • Resolution differences between cellular and whole-plant measurements

    • Compensation by redundant channels in planta

    • Indirect measurement approaches in complex tissues

Bridging Strategies:

  • Intermediate Experimental Systems:

    • Utilize Arabidopsis protoplasts as a transition between heterologous systems and intact plants

    • Develop ex vivo tissue preparations that maintain cellular context

    • Implement plant cell culture systems expressing native or modified KCO6

  • Parallel Measurement Approaches:

    • Design experiments that measure the same parameters in different systems

    • Develop calibrated methods that can be applied across experimental scales

    • Utilize computational modeling to predict scaling effects

  • Genetic Complementation Analysis:

    • Express in vitro-characterized KCO6 variants in kco6 knockout plants

    • Create transgenic plants with mutations identified as functional in vitro

    • Assess phenotypic rescue to connect molecular function with physiological roles

Reconciliation Framework:

Inconsistency TypeInvestigation ApproachIntegration Strategy
Calcium sensitivity differencesMeasure in situ calcium response curvesIdentify regulatory factors modifying sensitivity
Conductance discrepanciesSingle-channel recordings from native membranesAccount for native regulatory mechanisms
Subcellular localization variationsCompare trafficking in heterologous vs. plant cellsIdentify missing targeting determinants
Functional redundancy effectsCombinatorial knockout analysisCreate higher-order mutants to reveal masked phenotypes

By systematically addressing these discrepancies, researchers can develop more accurate models of KCO6 function that integrate insights from both in vitro and in planta studies.

What quality control measures should be implemented when working with recombinant KCO6 preparations?

Rigorous quality control is essential for reliable research with recombinant KCO6:

Protein Expression and Purification QC:

  • Expression Verification:

    • Western blot analysis with KCO6-specific or tag-specific antibodies

    • Quantitative assessment of expression levels across different preparations

    • Verification of expected molecular weight and detection of potential degradation

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining

    • Densitometry to quantify purity percentage

    • Mass spectrometry to identify contaminants or truncations

  • Structural Integrity:

    • Circular dichroism to assess secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to verify proper folding

Functional Quality Control:

  • Binding Activity Verification:

    • Calcium binding assays using isothermal titration calorimetry

    • Fluorescence-based calcium binding assays

    • Thermal stability shifts in presence vs. absence of calcium

  • Channel Functionality:

    • Reconstitution in liposomes for flux assays

    • Planar lipid bilayer recordings to verify channel conductance

    • Comparison to established reference channels with known properties

  • Batch-to-Batch Consistency:

    • Standard curve generation with reference preparations

    • Functional EC50 determination for calcium activation

    • Statistical comparison across multiple preparations

Standardized QC Protocol:

QC ParameterAcceptance CriteriaMethodology
Purity>90% by densitometrySDS-PAGE with Coomassie staining
IdentityCorrect mass (±0.1%)LC-MS
Calcium BindingKD within 20% of reference valueMicroscale thermophoresis
Channel FunctionConductance within 15% of referencePlanar lipid bilayer recording
StabilityTm ≥ 40°CDifferential scanning fluorimetry
Homogeneity>90% monodisperseSize exclusion chromatography

Implementing these quality control measures ensures experimental reproducibility and reliable data interpretation when working with recombinant KCO6 preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.