Recombinant Arabidopsis thaliana Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 (PIS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
PIS2; At4g38570; F20M13.130; Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2; Phosphatidylinositol synthase 2; AtPIS2; PI synthase 2; PtdIns synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PIS2
Target Protein Sequence
MAKQRPATLSVYLYIPNIVGYMRVLLNCIAFSVCFSNKTLFSLLYFFSFCCDAVDGWCAR KFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTFLSG KTSHKDVKDSTSWLFRLYYGNRMFMGYCCVSCEVLYIILLLIATNQTENLMNVVVKSLMQ ISPLSLLLALSIFGWSIKQIINVIQMKTAADVCVLYDIEKQHKKP
Uniprot No.

Target Background

Function
This enzyme catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as the PtdIns:inositol exchange reaction. It may act to reduce excessive cellular PtdIns content. The exchange activity is attributed to the reverse reaction of PtdIns synthase and is dependent on CMP, which binds tightly to the enzyme.
Database Links

KEGG: ath:AT4G38570

STRING: 3702.AT4G38570.1

UniGene: At.48962

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of PIS2 in Arabidopsis thaliana?

PIS2 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2) is a phosphatidylinositol synthase that catalyzes the formation of phosphatidylinositol from CDP-diacylglycerol and inositol. This enzyme plays a critical role in membrane phospholipid biosynthesis and is particularly important during phosphate limitation conditions. PIS2 belongs to a class of phosphate starvation-induced genes that help plants adapt to phosphorus-limited environments by participating in membrane lipid remodeling . The enzyme contains 225 amino acid residues and is expressed as a full-length protein in recombinant systems . While structurally and functionally related to phosphatase enzymes like PECP1 and PS2/PPsPase1, PIS2 specifically facilitates phospholipid metabolism rather than dephosphorylation reactions.

How is PIS2 expression regulated during phosphate starvation?

PIS2 expression is significantly upregulated during phosphate starvation as part of the plant's adaptive response. Similar to other phosphate starvation-induced genes like PS2, PIS2 contributes to membrane lipid remodeling, which is a critical adaptive mechanism that allows plants to conserve limited phosphate resources . During phosphate limitation, plants replace phospholipids with non-phosphorus galactolipids to release phosphate for essential cellular processes. PIS2 expression is regulated through phosphate starvation response pathways, which involve complex transcriptional networks and signaling cascades. Researchers investigating PIS2 regulation should consider examining its expression patterns in different tissues and under varying phosphate availability conditions using techniques such as RT-qPCR or reporter gene assays, similar to those used for studying PS2 expression .

What are the key structural features and domains of PIS2?

PIS2 is a 225 amino acid protein that contains catalytic domains characteristic of the CDP-alcohol phosphatidyltransferase family . While the search results don't provide specific structural information for PIS2, related enzymes in this family typically contain several transmembrane domains and active site residues essential for substrate binding and catalysis. The protein likely contains conserved motifs for CDP-diacylglycerol binding and inositol recognition. To study PIS2's structure-function relationship, researchers should consider performing sequence alignment with related phosphatidyltransferases, secondary structure prediction, and potentially expressing truncated versions of the protein to identify essential catalytic regions.

How can researchers detect and quantify PIS2 in plant tissues?

For detecting PIS2 in Arabidopsis tissues, researchers can employ several complementary approaches. Western blotting using antibodies specific to PIS2 or to epitope tags (such as His-tag) in recombinant versions is a standard method . Researchers might consider using antibodies similar to those developed for related proteins like CDIPT, which can be used for Western blot, immunohistochemistry, ELISA, and flow cytometry applications . For gene expression analysis, RT-qPCR can be used to quantify PIS2 mRNA levels in different tissues or under different conditions, similar to methods used for studying PP2-A5 expression in Arabidopsis . Creating translational fusions with reporter genes (like GFP or Venus) can also help visualize tissue-specific expression patterns and subcellular localization, as demonstrated for PECP1 and PS2 .

What are the optimal conditions for expression and purification of recombinant PIS2?

For optimal expression and purification of recombinant Arabidopsis thaliana PIS2, researchers should consider the following methodological approach:

Expression System Selection:
E. coli is a proven expression system for PIS2, particularly with His-tag fusion constructs . The full-length protein (amino acids 1-225) can be successfully expressed in this system.

Expression Optimization Protocol:

  • Clone the full-length PIS2 coding sequence into a suitable expression vector (pET or pQE series)

  • Transform into an E. coli expression strain (BL21(DE3) or Rosetta for possible rare codon optimization)

  • Test expression at different temperatures (16°C, 25°C, 37°C) and IPTG concentrations (0.1-1.0 mM)

  • Optimize induction time (4-16 hours)

Purification Strategy:

  • Harvest cells and lyse in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Purify using Ni-NTA affinity chromatography for His-tagged constructs

  • Implement a two-step purification process, adding size exclusion chromatography to increase purity

  • Consider adding 0.05-0.1% detergent (such as DDM or CHAPS) during purification to maintain protein solubility, as PIS2 is likely membrane-associated

This approach mirrors successful strategies used for related membrane-associated enzymes in Arabidopsis and should yield functional recombinant PIS2 suitable for biochemical and structural studies.

How can researchers effectively assess the enzymatic activity of PIS2 in vitro?

To assess PIS2 enzymatic activity in vitro, researchers should implement a multifaceted approach:

Enzymatic Assay Design:

  • Prepare reaction mixture containing purified recombinant PIS2, CDP-diacylglycerol substrate, inositol, and appropriate buffers with Mg²⁺ as cofactor

  • Incubate at 30°C for 30-60 minutes

  • Extract lipids using chloroform:methanol (2:1 v/v)

  • Analyze reaction products through:

    • Thin-layer chromatography (TLC) with appropriate phospholipid standards

    • HPLC for quantitative analysis

    • Mass spectrometry for detailed product characterization

Kinetic Parameter Determination:

  • Establish substrate saturation curves by varying CDP-diacylglycerol and inositol concentrations

  • Calculate Km and Vmax values for both substrates

  • Determine optimal pH and temperature conditions

Control Experiments:

  • Include heat-inactivated enzyme controls

  • Test activity in the presence of phospholipid inhibitors

  • Compare with activity of known PIS enzymes from other organisms

This comprehensive enzymatic characterization will provide valuable insights into PIS2's catalytic properties and substrate preferences, enabling comparison with related phosphatidyltransferases.

What is the role of PIS2 in membrane lipid remodeling during phosphate starvation?

PIS2 plays a crucial role in membrane lipid remodeling during phosphate starvation, contributing to the plant's adaptive response through several interconnected mechanisms:

Lipid Remodeling Pathway Involvement:
During phosphate limitation, plants undergo extensive membrane lipid remodeling to replace phospholipids with non-phosphorus galactolipids, thereby releasing phosphate for essential cellular processes . PIS2 likely functions in coordination with other enzymes to facilitate this membrane recomposition process.

Enzymatic Function in Phospholipid Metabolism:
As a CDP-diacylglycerol--inositol 3-phosphatidyltransferase, PIS2 catalyzes the synthesis of phosphatidylinositol (PI), which serves as a precursor for signaling molecules and membrane components. This activity may influence the balance between different phospholipid species during phosphate starvation.

Functional Relationship with Other Phosphate Starvation-Induced Enzymes:
PIS2 likely works in concert with other phosphate starvation-induced enzymes like PECP1 and PS2, which dephosphorylate phospholipid polar head groups in vivo . While PECP1 and PS2 function in releasing phosphate from phospholipids, PIS2 may contribute to restructuring the membrane lipid composition.

Experimental Approaches to Study PIS2's Role:

  • Compare lipid profiles between wild-type and PIS2 knockout/overexpression lines under normal and phosphate-limited conditions

  • Perform lipidomic analysis using LC-MS/MS to quantify changes in specific lipid species

  • Conduct pulse-chase experiments with labeled precursors to track lipid metabolism dynamics

  • Analyze membrane physical properties in plant lines with altered PIS2 expression

Understanding PIS2's precise role in this complex process requires integrating enzymatic, genetic, and lipidomic approaches to build a comprehensive model of phosphate starvation-induced membrane remodeling.

How does PIS2 compare to other phosphatidyltransferases in Arabidopsis?

PIS2 shares functional similarities with other phosphatidyltransferases in Arabidopsis, but exhibits distinct characteristics:

Comparative Enzymatic Properties:

FeaturePIS2Related PhosphatidyltransferasesReference
SubstrateCDP-diacylglycerol and inositolVaries by enzyme family
RegulationPhosphate starvation-inducedSome constitutively expressed, others stress-responsive
Protein Length225 amino acidsVariable, typically 200-500 amino acids
Subcellular LocalizationLikely endoplasmic reticulumER, Golgi, or plasma membrane depending on enzyme

Functional Distinctiveness:
While PIS2 specializes in phosphatidylinositol synthesis, other phosphatidyltransferases in Arabidopsis catalyze the formation of different phospholipids, such as phosphatidylcholine, phosphatidylethanolamine, and phosphatidylserine. This enzymatic diversity enables plants to maintain proper membrane composition and respond to environmental stresses.

Evolutionary Relationships:
Sequence analysis and phylogenetic studies would likely reveal that PIS2 belongs to a specialized clade of phosphatidyltransferases that evolved to function specifically in phosphate starvation responses, distinguishing it from constitutively expressed phosphatidyltransferases involved in basal lipid metabolism.

Research Methodologies for Comparative Studies:

  • Perform side-by-side enzyme assays with purified recombinant enzymes

  • Conduct complementation experiments in yeast mutants lacking specific phosphatidyltransferases

  • Compare expression patterns across tissues and stress conditions

  • Analyze phenotypes of single and multiple knockout mutants

This comparative approach would provide insights into the unique contributions of PIS2 to Arabidopsis lipid metabolism and stress responses.

What techniques can be used to study PIS2 subcellular localization in plant cells?

To determine the subcellular localization of PIS2 in plant cells, researchers can employ multiple complementary techniques:

Fluorescent Protein Fusion Approaches:

  • Generate N-terminal and C-terminal fusions of PIS2 with fluorescent proteins (GFP, YFP, or Venus)

  • Express these constructs in Arabidopsis using either stable transformation or transient expression systems

  • Visualize localization using confocal microscopy

  • Co-localize with established organelle markers to confirm precise subcellular distribution

This approach would be similar to the method used for PECP1 and PS2, which revealed their localization to the endoplasmic reticulum using Venus fluorescent reporter .

Immunolocalization Methods:

  • Develop specific antibodies against PIS2 or use antibodies against epitope tags in recombinant constructs

  • Perform immunofluorescence microscopy on fixed plant tissues or cells

  • Include controls with known subcellular markers

  • Use gold-labeled secondary antibodies for transmission electron microscopy to achieve higher resolution

Biochemical Fractionation:

  • Isolate different subcellular fractions (cytosol, microsomal, plasma membrane, etc.)

  • Detect PIS2 in these fractions using Western blotting

  • Compare distribution with known marker proteins for different organelles

  • Assess enzyme activity in different fractions

CRISPR-Based Proximity Labeling:
For advanced spatial proteomics, researchers could adapt CRISPR-based proximity labeling techniques by fusing PIS2 to enzymes like BioID or APEX2, which can biotinylate or otherwise tag neighboring proteins when activated, providing insights into the protein's immediate subcellular environment.

These approaches together would provide comprehensive information about PIS2's subcellular distribution and potential dynamic relocalization under different conditions such as phosphate starvation.

How can PIS2 be utilized in studies of plant adaptation to phosphate limitation?

PIS2 represents an excellent molecular tool for investigating plant adaptation to phosphate limitation, offering several research applications:

Genetic Engineering Approaches:

  • Generate PIS2 overexpression lines to evaluate whether enhanced PIS2 activity improves plant tolerance to phosphate limitation

  • Create knockout or knockdown lines using CRISPR/Cas9 or RNAi to assess the necessity of PIS2 for adaptation

  • Develop reporter lines with PIS2 promoter driving fluorescent protein expression to monitor phosphate starvation responses in real-time and in different tissues

Physiological and Biochemical Applications:

  • Use PIS2 expression as a molecular marker to quantify phosphate starvation response intensity across different experimental conditions or genetic backgrounds

  • Correlate PIS2 activity with membrane lipid composition changes during phosphate limitation

  • Investigate how PIS2-mediated alterations in phosphatidylinositol levels affect phosphoinositide signaling pathways during stress

Comparative Studies:

  • Examine PIS2 orthologs across plant species with different phosphate acquisition strategies

  • Investigate potential co-evolution of PIS2 with other components of phosphate starvation response

  • Compare PIS2 function with PS2 and PECP1 to understand the coordinated roles of different enzyme families in membrane remodeling

These applications would advance our understanding of the molecular mechanisms underlying plant adaptation to phosphate limitation and potentially inform strategies for developing crops with improved phosphorus use efficiency.

What recent methodological advances have improved the study of PIS2 and related enzymes?

Recent methodological advances have significantly enhanced our ability to study PIS2 and related enzymes:

Advanced Protein Expression Systems:

  • Plant-based transient expression systems using Nicotiana benthamiana

  • Cell-free protein synthesis platforms optimized for membrane proteins

  • Improved bacterial expression strains with rare codon supplementation and chaperone co-expression

Structural Biology Techniques:

  • Cryo-electron microscopy for membrane protein structure determination without crystallization

  • Advanced NMR methods for studying protein-lipid interactions

  • Computational approaches for predicting protein structure and substrate binding sites

Functional Genomics Tools:

  • CRISPR/Cas9-based genome editing for precise manipulation of PIS2 and related genes

  • Base editing and prime editing for introducing specific mutations without double-strand breaks

  • Inducible expression systems for temporal control of gene expression

Lipidomics Approaches:

  • High-resolution mass spectrometry for comprehensive lipid profiling

  • Imaging mass spectrometry for spatial distribution of lipids in plant tissues

  • Stable isotope labeling for tracking lipid metabolism dynamics

Cellular Imaging Innovations:

  • Super-resolution microscopy techniques (STORM, PALM) for visualizing subcellular structures beyond the diffraction limit

  • Live-cell imaging with improved fluorescent proteins and biosensors

  • Multi-parameter imaging for simultaneous visualization of multiple cellular components

Researchers can leverage these methodological advances to gain unprecedented insights into PIS2 structure, function, regulation, and its role in plant phosphate starvation responses and membrane lipid remodeling.

What strategies can overcome difficulties in expressing functional recombinant PIS2?

Researchers often encounter challenges when expressing membrane-associated enzymes like PIS2. Here are systematic approaches to troubleshoot expression difficulties:

Problem: Low Expression Levels
Solutions:

  • Optimize codon usage for the expression host

  • Test different promoter strengths and induction conditions

  • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Consider fusion partners known to enhance solubility (MBP, SUMO, Trx)

  • Implement auto-induction media instead of IPTG induction

Problem: Protein Insolubility/Aggregation
Solutions:

  • Lower expression temperature (16-18°C)

  • Add membrane-mimicking agents to lysis buffer (glycerol, mild detergents)

  • Test expression of truncated constructs lacking problematic domains

  • Co-express with molecular chaperones (GroEL/GroES)

  • Consider refolding protocols if inclusion bodies form

Problem: Enzymatic Inactivity
Solutions:

  • Ensure proper cofactor inclusion in purification and activity buffers

  • Verify protein folding using circular dichroism spectroscopy

  • Test activity in the presence of various lipid compositions to mimic native environment

  • Optimize detergent type and concentration during purification

  • Consider nanodiscs or liposome reconstitution for activity assays

Problem: Proteolytic Degradation
Solutions:

  • Include multiple protease inhibitors in all buffers

  • Reduce purification time by optimizing protocols

  • Test different N- or C-terminal tag positions

  • Consider on-column cleavage of fusion tags

  • Identify and mutate internal protease-sensitive sites

Implementing these strategies systematically will increase the likelihood of successfully producing functional recombinant PIS2 for biochemical and structural studies.

How can researchers address inconsistent results in PIS2 activity assays?

When facing variability in PIS2 enzyme activity assays, researchers should implement a systematic troubleshooting approach:

Standardization Protocol:

  • Enzyme Preparation Consistency:

    • Use single protein batches for comparative experiments

    • Standardize protein concentration determination methods

    • Verify enzyme purity by SDS-PAGE before each assay series

    • Store enzyme in small single-use aliquots to avoid freeze-thaw cycles

  • Substrate Quality Control:

    • Test multiple lots of CDP-diacylglycerol and inositol

    • Verify substrate purity by analytical methods

    • Prepare fresh substrate solutions for each experiment

    • Consider synthesizing or purifying substrates in-house for consistency

  • Assay Conditions Optimization:

    • Determine pH optima with narrow increments (0.2-0.3 pH units)

    • Establish precise temperature control during reactions

    • Optimize buffer composition (ionic strength, cofactors)

    • Determine linear range of enzyme concentration and reaction time

  • Product Detection Refinement:

    • Develop internal standards for quantification

    • Implement multiple detection methods (TLC, HPLC, mass spectrometry)

    • Establish standard curves with authentic standards

    • Consider radiometric assays for increased sensitivity

  • Statistical Approach:

    • Perform all assays in true biological triplicates (minimum)

    • Implement appropriate statistical tests for comparing conditions

    • Use power analysis to determine sample size requirements

    • Consider Bland-Altman plots to assess method agreement

By implementing this comprehensive troubleshooting strategy, researchers can significantly reduce variability in PIS2 activity assays and obtain more reliable and reproducible results.

How might PIS2 contribute to plant responses to multiple simultaneous stresses?

Plants in natural environments often face multiple stresses simultaneously, and understanding PIS2's role in these complex scenarios represents an emerging research frontier:

Intersection of Phosphate Limitation with Other Stresses:

Phosphate limitation rarely occurs in isolation, and PIS2 likely plays a role in integrated stress responses. Recent research on phosphate starvation-induced genes suggests several promising research directions:

  • Drought and Phosphate Co-limitation:

    • Investigate how PIS2-mediated membrane remodeling affects membrane fluidity and water permeability

    • Examine potential synergistic or antagonistic effects between drought and phosphate starvation on PIS2 expression

    • Study how altered phosphatidylinositol levels impact osmotic stress signaling pathways

  • Pathogen Response During Phosphate Limitation:

    • Explore parallels with defense proteins like PP2-A5, which contains TIR-lectin domains and confers defense properties against pests

    • Investigate whether PIS2-mediated membrane composition changes affect plant-pathogen interactions

    • Examine cross-talk between phosphate starvation and immune signaling pathways

  • Temperature Stress and Phosphate Starvation:

    • Study how membrane remodeling through PIS2 activity affects membrane thermostability

    • Investigate temperature-dependent kinetics of PIS2 enzyme activity

    • Examine how temperature extremes affect PIS2 expression and localization

  • Oxidative Stress Integration:

    • Explore whether PIS2-mediated changes in membrane composition affect reactive oxygen species (ROS) production and signaling

    • Investigate potential roles of phosphatidylinositol derivatives in oxidative stress responses

These research directions would contribute to our understanding of how plants cope with complex environmental challenges through coordinated molecular responses involving PIS2 and related enzymes.

What biotechnological applications might emerge from understanding PIS2 function?

Understanding PIS2 function could enable several innovative biotechnological applications:

Agricultural Innovations:

  • Development of crops with enhanced phosphorus use efficiency through optimized PIS2 expression

  • Creation of molecular markers for breeding programs targeting improved nutrient efficiency

  • Design of transgenic plants with altered membrane composition for stress tolerance

  • Development of biosensors using PIS2 promoter elements to monitor soil phosphate availability

Industrial Biotechnology:

  • Engineering microorganisms with optimized membrane lipid composition through heterologous PIS2 expression

  • Development of enzymatic processes for specialized phospholipid production

  • Creation of designer membranes with specific properties for bioreactors and biocatalysis

  • Production of high-value phosphatidylinositol derivatives for pharmaceutical applications

Research Tools:

  • Development of fluorescent biosensors based on PIS2 for studying phospholipid dynamics

  • Creation of activity-based probes for visualizing phosphatidyltransferase activities in living cells

  • Design of inhibitors or activators of PIS2 as chemical biology tools

  • Implementation of PIS2-based systems for controlled membrane remodeling in synthetic biology

Biomedical Applications:

  • Exploration of plant-derived phosphatidylinositols with potential bioactive properties

  • Investigation of PIS2 homologs in human pathogens as potential drug targets

  • Development of phosphatidylinositol production platforms for therapeutic applications

These diverse applications highlight the potential broader impacts of fundamental research on PIS2 function beyond plant biology, extending to agriculture, industrial biotechnology, and potentially medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.