Recombinant Arabidopsis thaliana Probable chlorophyll (ide) b reductase NYC1, chloroplastic (NYC1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana Probable Chlorophyll(ide) b Reductase NYC1, Chloroplastic (NYC1)

Recombinant Arabidopsis thaliana Probable Chlorophyll(ide) b Reductase NYC1, chloroplastic (NYC1) is an enzyme that plays a crucial role in chlorophyll degradation in plants . Specifically, it is involved in the conversion of chlorophyll b to chlorophyll a, which is the initial step in the chlorophyll cycle .

Key Features:

  • Gene Names: NYC1, F17N18.140, F17N18_140, NON-YELLOW COLORING 1

  • Other Names: Probable chlorophyll(ide) b reductase NYC1

  • Host: Cell-Free Expression

  • Purity: Greater or equal to 85% as determined by SDS-PAGE

  • Synonyms: NYC1; At4g13250; F17N18.140; Probable chlorophyll(ide b reductase NYC1, chloroplastic; Protein NON-YELLOW COLORING 1; AtNYC1

Function and Mechanism

NYC1 is a key enzyme that catalyzes the initial step in chlorophyll b degradation to 7-hydroxymethyl-chlorophyll a . In many green plants, NYC1 and NYC1-like (NOL) physically interact and may function as an enzymatic complex to co-catalyze the degradation of chlorophyll b .

Role in Chlorophyll Degradation

Chlorophyll degradation is a complex process that requires the participation of multiple enzymes . The degradation of chlorophyll first occurs through the process of converting chlorophyll b to chlorophyll a, which is the chlorophyll cycle . When the genes for chlorophyll b reductases NOL and NYC1 were disrupted in Arabidopsis thaliana, chlorophyll b and LHCII were not degraded during senescence .

Subcellular Localization and Interactions

Subcellular localization of ZjNOL in Zoysia japonica protoplast showed that ZjNOL was localized in the chloroplast . Theoretically, NOL can interact with NYC1 in plants such as Arabidopsis, rice, and ryegrass .

Experimental Data

SpeciesSourceTagProtein LengthPurity
Arabidopsis thalianaE. coliHisFull Length of Mature ProteinGreater than 90% as determined by SDS-PAGE

Research Findings

  • NYC1 and NOL are two key enzymes that catalyze the initial step in chlorophyll b degradation .

  • In Arabidopsis, NOL mainly plays a role in the vegetative growth stage and does not significantly promote the leaf senescence process .

  • ZjNOL and ZjNYC1 can interact with each other in Z. japonica chloroplasts .

  • When the genes for chlorophyll b reductases NOL and NYC1 were disrupted in Arabidopsis thaliana, chlorophyll b and LHCII were not degraded during senescence .

  • Single base pair mutations disrupted NYC1 function by three distinct mechanisms, one by producing a termination codon, the second by interfering with .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NYC1; At4g13250; F17N18.140; Probable chlorophyll(ide b reductase NYC1, chloroplastic; Protein NON-YELLOW COLORING 1; AtNYC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
44-496
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NYC1
Target Protein Sequence
CEKKVERKRKVEKFKGNGSWDSLKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSVAVQIA RYIVTMTSTGAILLIGFQLSGGDSSMNSLVWYSWLGGIIIGTMTGANMVLEDHYRAGPRN VVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKK LSDAKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQI VSTNLIGSILCTRGAMDVMSRQHSGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGS IVKESQKTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKG SGKAVNYLTPPRILLAIVTSWLRRGRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAME MYTENTWVSVFSLSVVCAFIILQSTTPSSFPGT
Uniprot No.

Target Background

Function
This protein is involved in chlorophyll b degradation and belongs to the chlorophyll catabolic enzymes (CCEs).
Gene References Into Functions

Functional Studies of Arabidopsis thaliana NON-YELLOW COLORING1 (NYC1):

  1. Increased mRNA and protein levels of NYC1 were observed following SGR overexpression in wild-type plants. Mg-dechelation of chlorophyll a by SGR activates chlorophyll b degradation by inducing NYC1 expression, demonstrating effective metabolic pathway regulation. PMID: 29425814
  2. Three single base-pair mutations disrupted NYC1 function: one created a stop codon; another interfered with intron splicing; and the third substituted a highly conserved proline with serine. PMID: 26261268
  3. NYC1-mediated chlorophyll b degradation is the initial step in optimizing light-harvesting capacity under high-light conditions. PMID: 25896488
  4. NYC1 accumulation requires chlorophyll b. PMID: 25557327
  5. NYC1 expression is regulated by abscisic acid. PMID: 22751379
Database Links

KEGG: ath:AT4G13250

STRING: 3702.AT4G13250.1

UniGene: At.3267

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NYC1 in chlorophyll metabolism and where is it localized in Arabidopsis thaliana?

NYC1 (Non-Yellow Coloring 1) is a chlorophyll b reductase that catalyzes the conversion of chlorophyll b to 7-hydroxymethyl chlorophyll a, which represents the first step in chlorophyll b degradation during senescence, embryogenesis, and seedling development.

Methodology for localization studies:

  • NYC1 localization can be determined using NYC1-GFP fusion proteins expressed in onion (Allium cepa) epidermal cells through particle bombardment. The fusion protein signal colocalizes with RFP fused to a plastid-localizing transit peptide from rice S9 ribosomal protein.

  • PSORT analysis predicts the N-terminal region may serve as a chloroplast transit peptide, albeit with low affirmativity.

  • The TMHMM server predicts that NYC1 has three transmembrane domains, with the SDR catalytic domain located between the second and third transmembrane domains, indicating chloroplast membrane localization .

Key findings:

  • NYC1 belongs to the classical short-chain dehydrogenase/reductase (SDR) family.

  • The protein contains a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK).

  • The presence of Arg at key positions 15 (180th amino acid) and 37 (202nd amino acid) suggests NADP(H) usage as a cofactor .

How does the nyc1 mutation affect chlorophyll ratios during senescence?

The nyc1 mutation significantly impairs chlorophyll degradation during senescence, resulting in the stay-green phenotype with altered chlorophyll a/b ratios compared to wild-type plants.

Methodological approach to measure chlorophyll content:

  • Extract chlorophylls from leaf tissue using acetone

  • Measure absorbance spectrophotometrically at specific wavelengths

  • Calculate chlorophyll a and b content using established equations

  • Monitor changes over time during dark-induced senescence

Experimental findings:

  • In nyc1 mutants, reduction of chlorophyll b content is severely affected during dark-induced senescence

  • At 8 days of dark incubation (DDI), chlorophyll a content in nyc1 is 5.1 times higher than wild type

  • Chlorophyll b content is 7.0 times higher than wild type at 8 DDI

  • The chlorophyll a/b ratio decreases earlier in nyc1 than in wild type, reaching approximately 1.2 at 8 DDI compared to a higher ratio in wild type

What is the relationship between NYC1 and NOL in Arabidopsis versus rice?

NYC1 and NOL (NYC1-Like) show differential functions between Arabidopsis and rice, demonstrating species-specific evolutionary adaptations in chlorophyll degradation pathways.

Methods to determine functional relationships:

  • Comparative genomic analysis of NYC1 and NOL genes across species

  • Phenotypic analysis of single and double mutants

  • Protein interaction studies

  • Complementation experiments

Research findings:

  • In rice, NOL and NYC1 are colocalized in the thylakoid membrane and function in a complex as a heteromeric chlorophyll b reductase enzyme

  • In rice, mutation in either NOL or NYC1 results in a stay-green phenotype

  • In Arabidopsis, NOL and NYC1 are differentially expressed during development

  • In Arabidopsis, only the nyc1 mutation produces a significant stay-green phenotype, while nol mutants exhibit nearly normal phenotypes

  • Phylogenetic analysis places NYC1 and NOL proteins in the same clade, suggesting similar but divergent functions

How does NYC1 expression change during leaf senescence and seed development?

NYC1 expression is developmentally regulated, showing distinct patterns during leaf senescence and seed development, with significant upregulation during these processes.

Methodological approaches:

  • Time-series RNA sampling during development stages

  • RT-PCR and qRT-PCR analysis

  • Western blotting for protein quantification

  • Promoter analysis using bioinformatics tools

Research findings:

  • NYC1 mRNA and NYC1 protein are in low abundance in green leaves but increase significantly during dark-induced senescence

  • Sequence analysis of the NYC1 promoter identified a potential abscisic acid (ABA)-responsive element

  • Electrophoretic mobility shift assay confirmed binding of an ABA-responsive transcriptional factor to the NYC1 promoter DNA fragment

  • NYC1 expression is repressed in ABA-insensitive mutants during embryogenesis

  • These findings suggest that NYC1 expression is regulated by ABA during seed maturation to produce storable seeds

What molecular mechanisms link NYC1 function to seed storability and germination?

The molecular pathway connecting NYC1 function to seed quality involves proper chlorophyll degradation during seed maturation, preventing oxidative damage from chlorophyll retention during storage.

Methodological approaches to study this connection:

  • Controlled seed aging experiments

  • Germination rate analysis over time

  • Chlorophyll content measurement in mature seeds

  • Electron microscopy of embryonic cells

  • Lipid peroxidation assays

Key research findings:

  • nyc1/nol double mutant seeds retain approximately 10 times more chlorophyll than wild-type seeds

  • Germination rates of nyc1/nol mutant rapidly decrease during storage, with most failing to germinate after 23 months, whereas 75% of wild-type seeds germinate after 42 months

  • Electron microscopic studies show that many small oil bodies appear in the embryonic cotyledons of the nyc1/nol mutant

  • Chlorophyll retention affects the development of organelles in embryonic cells

  • Oxidative damage from retained chlorophyll compromises membrane integrity in seeds, leading to reduced storability

How do transcription factors regulate NYC1 expression during ethylene-mediated chlorophyll degradation?

A sophisticated transcriptional regulatory network involving EIN3 and ORE1 controls NYC1 expression during ethylene-mediated chlorophyll degradation through a feed-forward mechanism.

Experimental approaches:

  • Chromatin immunoprecipitation (ChIP) assays

  • Electrophoretic mobility shift assays (EMSA)

  • Transient dual-luciferase reporter assays in Arabidopsis protoplasts

  • RT-qPCR kinetic expression analysis

  • Mutant analysis

Research findings:

  • EIN3 directly binds to the NYC1 promoter and activates its transcription

  • Transcript levels of NYC1 are greatly induced in wild-type plants in response to ethylene treatment

  • Ethylene induction of NYC1 is largely abolished in the ein3 eil1 double mutant

  • ORE1 significantly transactivates the NYC1 promoter

  • EIN3 and ORE1 have additive effects in activating the promoter of NYC1

  • This creates a feed-forward regulation of chlorophyll degradation involving EIN3, ORE1, and chlorophyll catabolic genes including NYC1

Activation data from dual-luciferase assays:

Transcription FactorNYC1 Promoter Activation (fold change)
Empty vector1.0
EIN3~3.5
ORE1~4.0
EIN3 + ORE1~6.0

What experimental approaches can determine the impact of chlorophyll b levels on NYC1 protein accumulation?

The relationship between chlorophyll b and NYC1 protein levels reveals a feedback mechanism in the chlorophyll cycle, which can be investigated through sophisticated genetic and biochemical approaches.

Methodological strategy:

  • Generate plants with altered chlorophyll b levels using truncated chlorophyllide a oxygenase gene

  • Induce senescence under controlled conditions

  • Quantify NYC1 mRNA by RT-qPCR

  • Detect NYC1 protein using Western blot analysis

  • Measure chlorophyll fluorescence parameters

Research discoveries:

  • When chlorophyll b levels are enhanced by introducing a truncated chlorophyllide a oxygenase gene and leaves are incubated in darkness, NYC1 protein accumulates to much higher levels than in wild type

  • Despite higher protein levels, NYC1 mRNA levels remain similar to wild type

  • In chlorophyll b-deficient mutants, NYC1 protein does not accumulate even though NYC1 mRNA levels increase significantly after dark incubation

  • The level of chlorophyll fluorescence in dark-adapted plants (Fo) correlates closely with NYC1 accumulation

  • This suggests NYC1 accumulation is related to energetically uncoupled light-harvesting complexes (LHC)

How can the aberrant cotyledon phenotype in nyc1 mutants be rescued through trans-complementation approaches?

Trans-complementation strategies using proteins unrelated to chlorophyll degradation but involved in chloroplast membrane protection can rescue developmental defects in nyc1 mutants, revealing mechanisms of oxidative damage.

Experimental methodology:

  • Generate VIPP1-GFP overexpression constructs

  • Cross VIPP1-GFP/Col with nyc1 mutants

  • Confirm transgene expression using Western blotting

  • Analyze cotyledon phenotypes under different light conditions

  • Examine chloroplast ultrastructure in unfixed cotyledons

Research findings:

  • NYC1 is solely responsible for the aberrant cotyledon development phenotype, which is not observed in nol mutants

  • Approximately 81% of nyc1 seedlings exhibit white or pale cotyledons

  • Overexpression of VIPP1 (a protein that supports chloroplast membrane integrity) in nyc1 completely rescues the aberrant cotyledon phenotype

  • Swollen chloroplasts observed in unfixed cotyledons of nyc1, characteristic of envelope membrane damage, are recovered by overexpressing VIPP1

  • The stay-green phenotype during leaf senescence remains despite VIPP1 overexpression

  • These results suggest that chloroplast membranes are targets for oxidative damage caused by impaired chlorophyll degradation

What are the optimal conditions for expressing and purifying recombinant NYC1 protein for in vitro enzymatic assays?

Producing functional recombinant NYC1 for enzymatic studies requires specialized approaches to overcome challenges related to its transmembrane domains and chloroplast localization.

Methodological protocol:

  • Construct design:

    • Clone the NYC1 coding sequence without the predicted transit peptide

    • Consider removing transmembrane domains for improved solubility

    • Introduce affinity tags (His, GST, or MBP) at the N-terminus

  • Expression systems:

    • E. coli strains optimized for membrane proteins (C41/C43)

    • Insect cell expression using baculovirus

    • Plant-based expression systems

  • Purification strategy:

    • Solubilization using mild detergents (DDM, LDAO)

    • Affinity chromatography

    • Size exclusion chromatography

  • Activity assay development:

    • Monitor conversion of chlorophyll b to 7-hydroxymethyl chlorophyll a using HPLC

    • Measure NADPH oxidation spectrophotometrically

    • Determine optimal pH, temperature, and cofactor requirements

Key considerations:

  • Maintaining protein stability and proper folding is critical for enzymatic activity

  • The presence of three transmembrane domains poses challenges for recombinant expression

  • NADP(H) should be included as a cofactor based on the presence of Arg at key positions 15 and 37

  • NOL protein shows chlorophyll b reductase activity in vitro and may be used as a positive control or alternative for assay development

How can NYC1 research benefit translational applications in agriculture and biomedicine?

NYC1 research extends beyond basic plant biology to applications in agriculture and potentially biomedicine through improved understanding of senescence, seed quality, and protein degradation pathways.

Translational research approaches:

  • CRISPR/Cas9 editing of NYC1 or its regulators in crop plants

  • Seed quality enhancement through controlled NYC1 expression

  • Comparative analysis of degradation pathways between plants and humans

  • Systems biology approaches to model senescence across kingdoms

Agricultural applications:

  • Engineering stay-green traits in crops for improved photosynthetic duration

  • Enhancing seed longevity and storability in important food crops

  • Developing stress-tolerant varieties with optimized chlorophyll turnover

Biomedical connections:

  • 70% of genes associated with human diseases, particularly neurological diseases and cancer, have orthologs in Arabidopsis

  • NYC1 research provides insights into regulated protein degradation pathways

  • Understanding membrane protein turnover mechanisms has relevance to human disease models

  • The chlorophyll degradation pathway parallels aspects of cellular detoxification systems in mammals

Educational value:

  • NYC1 and other Arabidopsis resources serve as important educational tools through programs like those offered by the Arabidopsis Biological Resource Center (ABRC)

  • These resources help address "plant blindness" in science education and promote plant biology research

What are the latest techniques for analyzing NYC1 interaction with the light-harvesting complex proteins?

Advanced biophysical and imaging techniques provide unprecedented insights into how NYC1 interacts with light-harvesting complex proteins during chlorophyll degradation.

Cutting-edge methodological approaches:

  • Proximity labeling techniques:

    • BioID or TurboID fusions with NYC1 to identify proximal proteins in vivo

    • Proximity-dependent biotin identification followed by mass spectrometry

  • Advanced imaging:

    • Super-resolution microscopy (PALM/STORM) with fluorescently tagged NYC1 and LHC proteins

    • Förster resonance energy transfer (FRET) to detect direct interactions

    • Single-particle cryo-electron microscopy for structural analysis

  • In situ protein interaction analysis:

    • Split fluorescent protein complementation assays

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence lifetime imaging microscopy (FLIM)

  • Quantitative proteomics:

    • SILAC or TMT labeling to compare protein abundances between wild-type and mutant plants

    • Targeted analysis of chlorophyll-binding proteins using selected reaction monitoring (SRM)

Research findings:

  • NYC1 deficiency results in selective retention of most LHCII isoforms during senescence

  • Immunoblotting shows that large amounts of LHCII apoproteins accumulate in nyc1 and nyc1/nol mutants, while only small amounts accumulate in wild-type and nol mutant seeds

  • Ultrastructural analysis of nyc1 chloroplasts reveals that large and thick grana are present even in late stages of senescence

  • This suggests that degradation of LHCII is required for proper degeneration of thylakoid membranes

How does NYC1 function synchronize with plant developmental timing and seasonal adaptation?

NYC1 activity integrates with broader developmental programs and environmental responses, affecting phenological transitions and seasonal adaptation in Arabidopsis.

Research methodologies:

  • Synchronized seed establishment (SSE) experiments with multiple cohorts planted at intervals

  • Controlled environment studies with variable photoperiod and vernalization treatments

  • Time-course transcriptomics during key developmental transitions

  • Phenotypic analysis across accessions with different flowering requirements

Key findings from synchronization studies:

  • In early-flowering accessions (C24 and Ler-1), bolting and flowering initiation are de-synchronized, with variance approximately eight times greater than germination timing variance

  • In late-flowering accessions requiring vernalization (Lov-5 and Tamm-2), bolting and flowering occur synchronously in spring for all cohorts

  • Flowering termination is strongly synchronized for all accessions, affecting the relationship between vegetative and flowering periods

  • These patterns affect chlorophyll metabolism during different developmental stages

NYC1 regulation in seasonal context:

  • NYC1 expression patterns differ between winter-annual and rapid-cycling life cycles

  • ABA-regulated NYC1 expression during seed maturation prepares seeds for seasonal dormancy

  • The timing of NYC1 activation during chlorophyll degradation is coordinated with other senescence-associated genes

  • Understanding this coordination has implications for adapting crops to different growing seasons and predicting responses to climate change

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.