Recombinant Arabidopsis thaliana Probable cyclic nucleotide-gated ion channel 12 (CNGC12)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

CNGC12 functions as a Ca²⁺-permeable channel with distinct regulatory mechanisms:

  • Electrophysiological Activity: In Xenopus oocytes, CNGC12 mediates inward Ca²⁺ and Mg²⁺ currents, unaffected by cyclic nucleotides (cAMP/cGMP) .

  • Calmodulin Interaction:

    • Apo-calmodulin binds the IQ motif, while Ca²⁺-bound calmodulin activates the channel via N-terminal CaMBDs .

    • Disruption of CaMBDs induces constitutive programmed cell death in planta .

  • Ion Selectivity: Permeable to Ca²⁺ and Mg²⁺ but impermeable to K⁺, Na⁺, or Ba²⁺ .

Channel Regulation and Calcium Signaling

  • CNGC12 overexpression in Arabidopsis alters cytosolic Ca²⁺ oscillations, impacting root hair growth and immune responses .

  • Co-expression with calmodulin 1 (CaM1) enhances channel activity, linking CNGC12 to pathogen defense and stress signaling .

Role in Plant Immunity

  • CNGC12 interacts with CaM1 to modulate hypersensitive response (HR) pathways, though it does not directly initiate HR .

  • Loss-of-function mutants exhibit impaired extracellular ATP (eATP)-induced Ca²⁺ influx in root epidermis, highlighting its role in damage signaling .

Table 2: Functional Comparison of CNGC12 and CNGC11

FeatureCNGC12CNGC11
Channel ActivityActive Ca²⁺ currentInactive
cNMP RegulationInsensitiveInsensitive
Calmodulin BindingMultiple CaMBDs (N/IQ/C-termini)Single C-terminal CaMBD
Subcellular LocalizationPlasma membranePlasma membrane

Applications in Research

Recombinant CNGC12 is widely used to:

  1. Study Ca²⁺ signaling mechanisms in plant-pathogen interactions .

  2. Investigate calmodulin-mediated ion channel regulation via electrophysiological assays .

  3. Engineer transgenic plants to dissect CNGC12’s role in developmental processes .

Technical Notes

  • Reconstitution: Requires sterile deionized water with 5–50% glycerol for stability .

  • Storage: Lyophilized powder retains activity for 12 months at -80°C; avoid repeated freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
CNGC12; At2g46450; F11C10.14; Probable cyclic nucleotide-gated ion channel 12; Cyclic nucleotide- and calmodulin-regulated ion channel 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-649
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CNGC12
Target Protein Sequence
MNHRRSKFARIDSMGVDGKLKSVRGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLF IPLIDSQRFCFTFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQASLRGEIVVH SKATLKTRLLFHFIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMY PLYKEVTRAFGTVAESKWAGAALNLFLYMLHSYVFGAFWYLSSIERKSKCWRAACARTSD CNLTVTDLLCKRAGSDNIRFLNTSCPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDF PRKFVYCFWWGLRNISALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSST TRVDEMEEKRRDTEKWMSYRVIPEYLKERIRRFEDYKWRETKGTEEEALLRSLPKDLRLE TKRYLYLDMLKRVPWLNIMDDGWLLEAVCDRVKSVFYLANSFIVREGHPVEEMLIVTRGK LKSTTGSHEMGVRNNCCDLQDGDICGELLFNGSRLPTSTRTVMTLTEVEGFILLPDDIKF IASHLNVFQRQKLQRTFRLYSQQWRSWAAFFIQAAWRKHCKRKLSKTRDNENIPQGTQLN LASTLYVSRFVSKALQNRRKDTADCSSSPDMSPPVPHKPADLEFAKAEA
Uniprot No.

Target Background

Function
Probable cyclic nucleotide-gated ion channel.
Gene References Into Functions
  1. In planta studies demonstrated that expression of CNGC12 with a nonfunctional N-terminal CaMBD constitutively induced programmed cell death, providing evidence of allosteric CNGC regulation by calmodulin (CaM). Furthermore, research indicated that CaM binding to the IQ motif is essential for channel function, highlighting the dual, positive and negative regulatory roles of CaM on CNGC12. PMID: 27335451
Database Links

KEGG: ath:AT2G46450

STRING: 3702.AT2G46450.1

UniGene: At.36508

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of CNGC12 in Arabidopsis thaliana?

CNGC12 functions primarily as an active calcium-permeable channel that mediates calcium influx across the plasma membrane. Electrophysiological studies utilizing the two-electrode voltage-clamp technique in Xenopus laevis oocyte heterologous expression systems have confirmed that CNGC12 permits inward calcium currents, unlike its close paralog CNGC11 . This calcium conductance is critical for several physiological processes including:

  • Immune response signaling, particularly in pathogen defense mechanisms

  • Programmed cell death regulation

  • Signal transduction in plant development

  • Thermotolerance responses

CNGC12 works cooperatively with other CNGCs, particularly CNGC11, and together they have been implicated in plant defense responses through separate but partially overlapping pathways .

How does CNGC12 differ structurally and functionally from other members of the CNGC family?

CNGC12 has distinctive structural and functional characteristics compared to other CNGCs:

  • Channel activity: CNGC12 functions as an active calcium channel, whereas its close paralog CNGC11 does not display similar channel activity in heterologous expression systems .

  • Protein interactions: CNGC12 can self-associate and also forms heteromeric complexes with CNGC19 and CNGC11 .

  • Regulation: CNGC12 is regulated through phosphorylation by BOTRYTIS INDUCED KINASE1 (BIK1), which stabilizes the protein .

  • Calcium permeability: CNGC12 mediates inward divalent cationic currents, particularly calcium ions, which is critical for its signaling function .

Unlike some other CNGCs, cyclic nucleotide monophosphates (cNMPs) do not appear to affect the activities of CNGC12 in the Xenopus oocyte system, suggesting unique regulatory mechanisms .

What phenotypes are associated with CNGC12 mutations in Arabidopsis?

Mutations in CNGC12 lead to several distinct phenotypes:

  • The chimeric constitutive expresser of PR genes22 (cpr22) mutant, resulting from a fusion between CNGC11 and CNGC12, displays autoimmune phenotypes with increased salicylic acid (SA) accumulation and constitutive pathogenesis-related (PR) gene expression .

  • Unlike dnd1 (CNGC2 mutant) and hlm1/dnd2 (CNGC4 mutant), cpr22 mutants retain the ability to induce hypersensitive response (HR) when challenged with avirulent pathogens .

  • cpr22 constitutively expresses the jasmonic acid (JA)-inducible antifungal defensin gene PDF1.2, indicating activation of both SA-dependent and JA/ethylene-dependent signaling pathways .

  • Specific point mutations in CNGC12, such as those identified in suppressor screens of cpr22, can abolish the autoimmune phenotypes, suggesting critical residues for channel function .

What are the optimal methods for recombinant expression and purification of CNGC12?

For successful recombinant expression and purification of CNGC12, researchers should consider the following methodological approach:

  • Expression system selection:

    • Xenopus laevis oocytes for electrophysiological studies

    • Nicotiana benthamiana for transient plant expression

    • Saccharomyces cerevisiae for functional complementation assays

    • E. coli systems for protein purification (with modifications for membrane proteins)

  • Construct design considerations:

    • Include appropriate tags (GFP, His-tag) for detection and purification

    • Consider codon optimization for the expression system

    • Design chimeric constructs or truncations to enhance expression

    • Include native or strong promoters (35S for plant expression)

  • Purification strategy:

    • Solubilization with appropriate detergents for membrane proteins

    • Affinity chromatography using tags

    • Size exclusion chromatography for oligomeric state determination

    • Fast protein liquid chromatography (FPLC) for high purity

  • Quality control:

    • Western blotting to confirm expression and size

    • Mass spectrometry for protein identification

    • Circular dichroism to assess secondary structure

    • Functional assays to confirm activity

How can I design experiments to study CNGC12 channel activity?

To effectively study CNGC12 channel activity, researchers should implement multiple complementary approaches:

  • Electrophysiological approaches:

    • Two-electrode voltage-clamp (TEVC) technique in Xenopus oocytes is the gold standard for measuring channel conductance

    • Whole-cell patch-clamp recordings in heterologous systems

    • Design voltage protocols to characterize channel kinetics, ion selectivity, and gating properties

  • Calcium imaging techniques:

    • Use fluorescent calcium indicators (Fluo-4, Fura-2) in expressing cells

    • Employ genetically encoded calcium indicators (GCaMPs) in plant systems

    • Perform time-lapse confocal microscopy to measure calcium transients

  • Key controls and parameters:

    • Test multiple ion conditions (Ca²⁺, Mg²⁺) at physiologically relevant concentrations

    • Include cyclic nucleotide treatments (cAMP, cGMP) to test regulation

    • Compare wild-type and mutant versions of the channel

    • Use appropriate channel blockers for verification

  • Data analysis considerations:

    • Measure current-voltage relationships

    • Calculate ion selectivity ratios

    • Determine activation/inactivation kinetics

    • Assess channel open probability

Research has shown that CNGC12 mediates inward currents in the presence of 30 mM extracellular Ca²⁺ or Mg²⁺, confirming its function as an active calcium channel, unlike CNGC11 which does not show similar activity under identical conditions .

How do protein-protein interactions regulate CNGC12 function?

CNGC12 function is regulated through a complex network of protein-protein interactions:

  • Homomeric and heteromeric channel formation:

    • CNGC12 can self-associate to form homomeric channels

    • CNGC12 forms heteromeric complexes with CNGC11, as demonstrated by bimolecular fluorescence complementation (BiFC) analysis

    • CNGC12 also interacts with CNGC19 to form functional heteromeric channels

  • Calmodulin (CaM) interaction:

    • CaM1-mediated regulation plays a crucial role in CNGC12 activity

    • BiFC assays in Arabidopsis mesophyll protoplasts have confirmed the interaction between CNGC12 and CaM1

    • The CaM-binding domain in CNGC12 is essential for this regulation

  • Kinase-mediated regulation:

    • BOTRYTIS INDUCED KINASE1 (BIK1) phosphorylates and stabilizes CNGC12

    • This phosphorylation affects channel activity and may be a key regulatory mechanism during immune responses

  • Methodological approaches to study these interactions:

    • Yeast two-hybrid (Y2H) assays using the pGBKT7 vector system for CNGC12 fragments and various CaM/CML proteins

    • Bimolecular fluorescence complementation using vectors like pSAT1-nVenus-N or pSAT1-cCFP-N for visualization in plant cells

    • Co-immunoprecipitation followed by mass spectrometry to identify novel interactors

    • FRET/FLIM analysis for dynamic interaction studies in living cells

What is the relationship between CNGC12 and defense signaling pathways?

CNGC12 plays a complex role in defense signaling pathways, interacting with multiple immunity-related systems:

  • Salicylic acid (SA) pathway interactions:

    • CNGC12 mutants (particularly the chimeric cpr22) show increased SA accumulation

    • Enhanced resistance to bacterial pathogen Pseudomonas syringae and oomycete pathogen Hyaloperonospora arabidopsidis is SA-dependent

    • Mutations affecting SA accumulation or perception abolish the enhanced resistance phenotypes

  • Jasmonic acid (JA) and ethylene (ET) crosstalk:

    • cpr22 constitutively expresses the JA-inducible antifungal defensin gene PDF1.2

    • This expression is suppressed when crossed to mutants of JA/ET signaling

    • Unlike some other CNGC mutants, cpr22 activates both SA-dependent and JA/ET-dependent pathways

  • Calcium signaling integration:

    • CNGC12-mediated calcium influx serves as a second messenger for both pattern-triggered immunity (PTI) and effector-triggered immunity (ETI)

    • Calcium signals activate downstream defense components

    • Mis-regulation of CNGC12 calcium channel activity affects both PTI and ETI responses

  • Hypersensitive response (HR) regulation:

    • cpr22 mutants exhibit calcium-dependent spontaneous cell death

    • Unlike dnd1 and hlm1/dnd2 mutants, cpr22 can induce HR in response to avirulent pathogens

    • This suggests different molecular mechanisms governing defense signaling between CNGC family members

What mutational analyses have revealed critical structural elements of CNGC12?

Extensive mutational analyses have provided insights into CNGC12 structure-function relationships:

MutationLocationPhenotypic EffectFunctional ImpactReference
G459RPore regionLoss of cpr22 phenotypesDisrupted channel activity
R381HTransmembrane domainLoss of cpr22 phenotypesAltered ion conductance
L371FTransmembrane inward surfaceIncreased cytosolic Ca²⁺Mis-regulation of channel activity
Various suppressors (29 alleles)Multiple domainsSuppression of autoimmunityAltered channel function

Key structural insights include:

  • Transmembrane domains:

    • The L371F exchange on a predicted transmembrane channel inward surface leads to increased cytosolic Ca²⁺ accumulation without disrupting protein interactions

    • This suggests this region is critical for regulating channel gating rather than protein assembly

  • Pore region:

    • Mutations in the pore region (like G459R) abolish channel activity without necessarily affecting protein stability

    • These residues are likely critical for ion selectivity and conductance

  • Regulatory domains:

    • Several mutations have been identified as counterparts of human CNGA3 (a human CNGC) mutants

    • This evolutionary conservation suggests fundamental mechanisms of channel regulation

  • Structure-based computational modeling approaches:

    • Homology modeling based on better-characterized mammalian CNGCs

    • Identification of critical residues through comparison with human CNGA3

    • Molecular dynamics simulations to understand conformational changes

How can I design CRISPR-Cas9 experiments to study CNGC12 function?

When designing CRISPR-Cas9 experiments to study CNGC12 function, consider these methodological approaches:

  • Guide RNA design strategy:

    • Target conserved functional domains: cyclic nucleotide-binding domain, pore region, or calcium-binding sites

    • Design multiple guide RNAs to increase editing efficiency

    • Avoid off-target effects by using prediction tools

    • Consider targeting regions identified in mutational studies, such as the transmembrane domains or pore regions implicated in channel function

  • Editing approach selection:

    • Knockout: Complete gene disruption to assess loss-of-function

    • Knock-in: Introduce specific mutations analogous to those found in suppressor screens (e.g., G459R, R381H)

    • Base editing: For precise nucleotide changes without double-strand breaks

    • Prime editing: For more complex edits without donor templates

  • Validation methods:

    • Sequencing to confirm edits

    • RT-qPCR to assess transcript levels

    • Western blotting to confirm protein expression changes

    • Phenotypic analysis (pathogen response, calcium imaging)

    • Electrophysiology to assess channel function

  • Experimental controls:

    • Include wild-type controls

    • Use Cas9-only or non-targeting gRNA controls

    • Generate complementation lines to confirm phenotypes are due to the edit

    • Create multiple independent lines to rule out positional effects

What are the best approaches for studying CNGC12's role in calcium signaling?

To effectively study CNGC12's role in calcium signaling, implement these research strategies:

Research has demonstrated that CNGC12 mediates inward currents in the presence of extracellular Ca²⁺ or Mg²⁺, confirming its function as an active calcium channel . Additionally, mutations like L371F lead to increased cytosolic Ca²⁺ accumulation, consistent with mis-regulation of CNGC12 Ca²⁺-permeable channel activity .

How should I address contradictory findings about CNGC12 regulation by cyclic nucleotides?

When addressing contradictory findings regarding CNGC12 regulation by cyclic nucleotides:

  • Methodological considerations:

    • Experimental system differences: Results may vary between heterologous systems (oocytes, yeast) and native plant systems

    • Concentration effects: Test multiple concentrations of cyclic nucleotides, as regulation may be dose-dependent

    • Technical approach variations: Electrophysiology vs. calcium imaging may yield different results

    • Protein modification status: Post-translational modifications may affect cyclic nucleotide sensitivity

  • Contradictory findings in the literature:

    • Some studies report that cyclic nucleotide monophosphates (cNMPs) did not affect the activities of CNGC12 in Xenopus oocytes

    • Other studies suggest cyclic nucleotide binding is important for channel function

    • These contradictions may reflect system-specific differences or experimental conditions

  • Resolution approaches:

    • Direct comparison experiments using identical constructs in multiple systems

    • Structure-function studies targeting the cyclic nucleotide-binding domain

    • Biophysical assays to directly measure cyclic nucleotide binding

    • Computational modeling to predict regulatory mechanisms

  • Experimental design for resolving contradictions:

    • Use both electrophysiological and calcium imaging approaches

    • Include positive controls (known cyclic nucleotide-regulated channels)

    • Test effects in both heterologous systems and native plant cells

    • Combine pharmacological and genetic approaches

What are the challenges in interpreting CNGC12 heterologous expression data?

Interpreting heterologous expression data for CNGC12 presents several challenges that researchers should address:

  • System-specific limitations:

    • Differences in membrane composition between expression systems and plant cells

    • Absence of plant-specific regulatory proteins in heterologous systems

    • Post-translational modification variations across expression systems

    • Protein trafficking and localization differences

  • Technical considerations:

    • Expression levels may affect channel properties

    • Formation of heteromeric channels with endogenous proteins

    • Variability in channel activity measurements between systems

    • Different experimental conditions (ionic strength, pH, temperature)

  • Data interpretation strategies:

    • Compare results across multiple expression systems

    • Validate heterologous findings in plant systems when possible

    • Use computational modeling to predict system-specific effects

    • Control for expression levels and proper trafficking

  • Specific challenges with CNGC12:

    • CNGC12 functions as an active calcium channel in Xenopus oocytes, but regulatory mechanisms may differ from native contexts

    • Protein-protein interactions with CaM1 or other regulatory partners may be absent in some systems

    • Channel complex formation with other CNGCs (CNGC11, CNGC19) may not occur in heterologous systems

What are the emerging techniques for studying CNGC12 structure and function?

Emerging techniques that will advance CNGC12 research include:

  • Structural biology approaches:

    • Cryo-electron microscopy (cryo-EM) for high-resolution structural determination

    • Single-particle analysis of purified CNGC12 complexes

    • X-ray crystallography of isolated domains (cyclic nucleotide-binding domain)

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) for subcellular localization

    • Optogenetic tools to control CNGC12 activity with light

    • Single-molecule tracking to study channel dynamics in living cells

    • FRET-based sensors to monitor conformational changes

  • Computational approaches:

    • AlphaFold2 or RoseTTAFold predictions of CNGC12 structure

    • Molecular dynamics simulations of ion permeation and gating

    • Machine learning for predicting regulatory interactions

    • Systems biology modeling of CNGC12 in calcium signaling networks

  • High-throughput functional screens:

    • CRISPR screens for regulators and interactors

    • Chemical genetics to identify small molecule modulators

    • Proteomics approaches to map the CNGC12 interactome

    • Synthetic biology redesign of channel properties

How can researchers integrate CNGC12 studies with broader plant immunity research?

To integrate CNGC12 research with broader plant immunity studies:

  • Multi-omics approaches:

    • Transcriptomics to identify CNGC12-dependent gene expression changes during immune responses

    • Proteomics to map signaling networks connecting CNGC12 to defense outputs

    • Metabolomics to characterize defense compounds affected by CNGC12 function

    • Integration of these datasets to build comprehensive immunity models

  • Systems-level experimental designs:

    • Study CNGC12 in the context of multiple immunity mutants

    • Investigate interactions with both pattern-triggered immunity (PTI) and effector-triggered immunity (ETI) pathways

    • Examine crosstalk between salicylic acid and jasmonic acid signaling mediated by CNGC12

    • Explore CNGC12 function across diverse pathogen challenges

  • Translational approaches:

    • Engineer CNGC12 variants for enhanced disease resistance

    • Study CNGC12 orthologs in crop species

    • Develop predictive models of calcium signature effects on immunity

    • Design rational strategies to modulate CNGC12 activity for agricultural applications

  • Collaborative research frameworks:

    • Combine expertise in electrophysiology, plant pathology, and structural biology

    • Develop standardized assays for comparing results across labs

    • Create community resources for CNGC research (mutant collections, antibodies)

    • Establish interdisciplinary training programs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.