Recombinant Arabidopsis thaliana Probable gamma-secretase subunit PEN-2 (At5g09310)

Shipped with Ice Packs
In Stock

Description

General Information

Arabidopsis thaliana Probable Gamma-Secretase Subunit PEN-2 (At5g09310) is a protein that is believed to be a subunit of the gamma-secretase complex in Arabidopsis thaliana, also known as thale cress . Gamma-secretase is an endoprotease complex, which cleaves integral membrane proteins within the membrane .

Table 1: General Information for At5g09310

PropertyValue
Gene NameAt5g09310
SynonymsT5E8.110, Probable gamma-secretase subunit PEN-2
SpeciesArabidopsis thaliana
Protein Length146 amino acids (full length)
Molecular Weightapproximately 16.5 kDa (estimated based on amino acid sequence)
PurityGreater than 85% as determined by SDS-PAGE
TagHis-tagged
UniProt IDQ9FY84

Structure and Sequence

The recombinant protein consists of 146 amino acids . The protein includes a His-tag, which is used for purification purposes .

Table 2: Amino Acid Sequence

PropertyValue
Amino SequenceMEATRSDDPSLNPIRNRNPNPNPNPNPLSTIISSAQVWPTIDGPLGLTEEASVDYARRFYKFGFALLPWLWFVNCFYFWPVLRHSRAFPQIRNYVVRSAIGFSVFTALLSAWALTFSIGGEQLFGPLYDKLVMYNVADRLGLSGLA

Function

PEN-2 is essential for gamma-secretase complex stability and trafficking . The gamma-secretase complex is crucial in various signaling pathways. It plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels .

Production and Sourcing

Recombinant At5g09310 is produced in E. coli . The protein is available from multiple commercial sources . It is usually supplied as a lyophilized powder and needs to be reconstituted in sterile water or a suitable buffer .

Research Applications

Recombinant At5g09310 is used in biochemical and biophysical studies . Some applications include:

  • As a control or standard in immunoassays

  • Studying protein-protein interactions

  • Investigating the structure and function of the gamma-secretase complex

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
At5g09310; T5E8.110; Probable gamma-secretase subunit PEN-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g09310
Target Protein Sequence
MEATRSDDPSLNPIRNRNPNPNPNPNPLSTIISSAQVWPTIDGPLGLTEEASVDYARRFY KFGFALLPWLWFVNCFYFWPVLRHSRAFPQIRNYVVRSAIGFSVFTALLSAWALTFSIGG EQLFGPLYDKLVMYNVADRLGLSGLA
Uniprot No.

Target Background

Function

Probable subunit of the γ-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.

Gene References Into Functions
  1. All γ-secretase subunits (PS1/PS2, APH-1, PEN-2, and NCT) colocalize and interact in Arabidopsis thaliana protoplasts. [AtPEN-2] PMID: 24723404
Database Links

KEGG: ath:AT5G09310

STRING: 3702.AT5G09310.1

UniGene: At.32532

Protein Families
PEN-2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of PEN-2 in Arabidopsis thaliana?

PEN-2 (PENETRATION2) in Arabidopsis thaliana serves dual roles in plant biology. It functions as an essential component of the gamma-secretase complex, a multisubunit proteolytic complex that requires all four components (presenilin, nicastrin, Aph-1, and Pen-2) for proper activity . Simultaneously, PEN-2 acts as a central component in plant immunity, particularly in cell wall-based defense against non-adapted pathogens like the powdery mildew Blumeria graminis fsp. hordei (Bgh) .

For researchers investigating PEN-2 function, several methodological approaches are recommended:

  • Generate knockout or knockdown mutants to assess phenotypic changes in both defense responses and developmental processes

  • Employ fluorescent protein tagging to visualize subcellular localization during infection and normal growth

  • Use co-immunoprecipitation assays to identify interaction partners in both gamma-secretase and defense pathways

  • Implement complementation studies with specific domain mutations to identify critical functional regions

  • How is the structure of Arabidopsis PEN-2 organized?

Arabidopsis PEN-2 exhibits a highly conserved structure with critical functional domains. The protein comprises lumenal N- and C-termini, two transmembrane domains (TMDs), and a cytosolic loop region . Glycosylation studies have confirmed this topology . The first TMD interacts with TMD4 of presenilin (PS1) and is localized to a water-accessible pore . The cytosolic loop region is accessible from the lumenal side via a hydrophilic cavity and may interact with PS1-CTF .

The C-terminal region is particularly important for gamma-secretase complex stability, while an endoplasmic retention signal sequence in TMD1 appears critical for trafficking . PEN-2's remarkable sequence conservation between Homo sapiens and Arabidopsis thaliana suggests fundamental functional importance .

For structural studies, researchers should consider:

  • Implementing systematic mutagenesis of conserved residues across different domains

  • Using topology mapping with site-specific labeling techniques

  • Employing glycosylation site insertion to confirm membrane orientation

  • Conducting deletion analysis to identify minimal functional domains

  • What expression systems are optimal for recombinant Arabidopsis PEN-2?

For efficient expression of functional recombinant Arabidopsis PEN-2, insect cell-based systems have proven most effective. A baculovirus expression system in Sf9 host cells allows for the simultaneous expression of all four gamma-secretase components (presenilin, nicastrin, Aph-1, and Pen-2) from a single plasmid . This approach ensures 100% co-infection and co-expression of all components, critical for studying the assembled complex .

The methodological workflow includes:

  • Subcloning all four gamma-secretase components into a single expression vector

  • Generating recombinant baculovirus for infection of Sf9 cells

  • Optimizing expression conditions (temperature, infection time, MOI)

  • Implementing appropriate detergent-based extraction protocols to maintain complex integrity

  • Employing affinity purification with tags that minimally impact function

This system provides a powerful tool for in vitro studies of the putative proteolytic function of recombinant Arabidopsis gamma-secretase .

  • How does PEN-2 interact with other proteins in defense pathways?

PEN-2 functions within a sophisticated network of proteins involved in plant immunity. In defense responses, PEN-2 works coordinately with PEN1 (a syntaxin) and PEN3 (an ABC transporter) to provide resistance against non-adapted pathogens . Loss-of-function mutations in any of these three genes cause decreased hypersensitive cell death triggered by recognition of effectors from oomycete and bacterial pathogens, with considerable additive effects when mutations are combined .

For studying these interactions:

  • Generate and characterize single, double, and triple mutant combinations

  • Employ co-localization studies during pathogen infection

  • Use bimolecular fluorescence complementation to confirm direct interactions

  • Implement genetic complementation with domain-swapped chimeric proteins

  • What is the relationship between PEN-2 and indole glucosinolate metabolism?

PEN-2 plays a critical role in the metabolism of indole glucosinolates (IGs), which are important antimicrobial compounds in Arabidopsis. The biosynthesis pathway begins with CYP79B2 and CYP79B3 converting tryptophan (Trp) into indole-3-acetaldoxime (IAOx) . This precursor is then converted into several compounds for antimicrobial immunity, including PEN2 substrates indole-glucosinolates (IGs) .

PEN-2 functions as an atypical myrosinase that hydrolyzes these IGs into bioactive compounds with antimicrobial activity . The cyp79B2 cyp79B3 double mutant, which cannot produce IGs, shows extreme susceptibility to pathogens like Alternaria brassicicola (Ab) . In contrast, the pen2 mutation alone has little effect on resistance to Ab in the Col-0 accession, suggesting pathogen-specific roles for PEN-2-mediated IG metabolism .

For researchers studying this pathway:

  • Implement targeted metabolite profiling to quantify IG derivatives in different genetic backgrounds

  • Use LC-MS/MS to monitor changes in metabolite profiles during infection

  • Combine mutations in biosynthetic and metabolic genes to dissect pathway contributions

  • Employ enzyme assays with recombinant PEN-2 and purified substrates

Advanced Research Questions

  • How do mutations in PEN-2 affect gamma-secretase complex stability and function?

Systematic mutagenesis studies have revealed domain-specific effects of PEN-2 mutations on gamma-secretase function . The effects vary significantly depending on the mutation location:

Mutation RegionEffect on PS1 EndoproteolysisEffect on Proteolytic ActivityEffect on Complex Stability
First half of TMD1DecreasedDecreasedMinimal effect
Second half of TMD1Minimal effectIncreasedMinimal effect
Cytosolic loopMinimal effectDecreasedVariable effects
TMD2DecreasedVariable effectsMinimal effect
First half of TMD2Minimal effectDecreasedMinimal effect
C-terminal residuesMinimal effectDecreasedDecreased

Specific mutations of interest include:

  • N33A in TMD1: Increases gamma-secretase complexes at the cell surface and modestly decreases stability

  • I53A in the loop region: Reduces stability 10-fold and proteolytic activity by half

  • E4R, E9A, L12A, L14A, R16A, and K17A in the N-terminal region: Increase the PS1-CTF:Pen-2 ratio, primarily by reducing Pen-2 stability rather than increasing endoproteolysis

Notably, minor PS1 endoproteolysis can occur in the complete absence of Pen-2, suggesting that rather than solely being a catalyst for endoproteolysis, Pen-2 may stabilize the complex prior to PS1 endoproteolysis, allowing time for full assembly and proper trafficking .

  • What methodologies are most effective for studying PEN-2's role in hypersensitive response (HR)?

To effectively study PEN-2's role in the hypersensitive response, researchers should implement an integrated approach combining genetic, cellular, and biochemical methods:

Genetic approaches:

  • Generate higher-order mutants combining pen2 with other immunity pathway mutants

  • Create pen2 mutants in different Arabidopsis accessions to assess genetic background effects

  • Develop tissue-specific or inducible pen2 knockdown lines to separate developmental from defense functions

Cellular and microscopic techniques:

  • Use live-cell imaging with fluorescently-tagged PEN-2 to track subcellular localization during pathogen attack

  • Implement trypan blue staining to quantify cell death responses

  • Employ ion leakage measurements as a quantitative proxy for HR

Pathogen challenge assays:

  • Challenge plants with diverse pathogens with different lifestyles (biotrophs, necrotrophs, hemibiotrophs)

  • Use pathogens expressing different effectors to assess specificity

  • Monitor infection at different timepoints to capture dynamic responses

Comparative analysis of different pen mutants reveals a complex picture. The pen2 pen3 and pen1 pen3 double mutants show almost complete abolishment of HR induced by AvrRpm1, while surprisingly displaying varying degrees of run-away cell death in response to Bgh . This indicates complex, pathogen-specific roles for PEN proteins that extend beyond their previously recognized functions in cell wall-based defense .

  • How can chromatin immunoprecipitation techniques be optimized for studying PEN-2 regulation during stress responses?

Understanding the transcriptional regulation of PEN-2 during stress responses requires optimized chromatin immunoprecipitation (ChIP) techniques:

  • Sample preparation optimization:

    • Use flash-frozen tissue collected at precise timepoints after pathogen challenge or cold stress

    • Implement crosslinking with 1% formaldehyde for exactly 10 minutes to preserve protein-DNA interactions

    • Optimize sonication conditions to generate 200-500bp DNA fragments for high-resolution analysis

  • IP optimization:

    • Use antibodies against specific transcription factors known to regulate defense genes

    • Implement the CAP-C (Crosslinking, Antibody Purification, PCR) technique for improved resolution of chromatin contacts

    • Add spike-in controls with chromatin from a different species for quantitative normalization

  • Analysis approaches:

    • Use qPCR for targeted analysis of PEN-2 promoter regions

    • Implement ChIP-seq for genome-wide binding profiles

    • Correlate with transcriptomic data from RNA-seq to identify functional binding events

Recent research suggests chromatin contacts are significantly associated with Pol II activities at the gene level and undergo dynamic changes during stress responses . For example, during cold treatment (3-h and 12-h at 4°C), chromatin dynamics were coupled with transcriptional reprogramming . These techniques could reveal similar regulatory mechanisms for PEN-2 during pathogen stress.

  • What are the most effective strategies for engineering enhanced PEN-2 function in crop plants?

Engineering enhanced PEN-2 function in crop plants for improved disease resistance requires strategic approaches:

  • Structure-function optimization:

    • Use site-directed mutagenesis to enhance substrate affinity or catalytic efficiency based on the Arabidopsis model

    • Create chimeric proteins combining domains from PEN-2 homologs with different substrate preferences

    • Optimize protein stability while maintaining function through targeted amino acid substitutions

  • Expression optimization:

    • Select tissue-specific or pathogen-inducible promoters to minimize fitness costs

    • Use synthetic promoters with optimized regulatory elements for rapid response to pathogen detection

    • Implement precise gene editing rather than overexpression to maintain native regulatory control

  • Pathway engineering:

    • Co-engineer upstream enzymes (CYP79B2/B3) to ensure substrate availability

    • Modify transporters to optimize localization of bioactive compounds

    • Consider engineering downstream metabolic enzymes to prevent accumulation of potentially toxic intermediates

  • Validation strategies:

    • Perform infection assays with multiple agriculturally relevant pathogens

    • Assess potential trade-offs between enhanced immunity and growth/yield

    • Test in multiple environmental conditions to ensure robust function

Research shows that PEN-2 function extends beyond single pathogen resistance, as mutations affect responses to diverse pathogens including powdery mildew, oomycetes, and bacterial pathogens . This broad-spectrum functionality makes PEN-2 an attractive target for crop improvement.

  • How can structural modeling inform mutations that dissociate PEN-2's dual roles in immunity and gamma-secretase function?

Structural modeling approaches can help dissociate PEN-2's dual roles through informed mutational strategies:

  • Homology modeling techniques:

    • Generate models based on related proteins with known structures

    • Use evolutionary conservation patterns across species to identify functionally important residues

    • Implement molecular dynamics simulations to identify conformational flexibility

  • Functional domain mapping:

    • The first TMD interacts with presenilin TMD4 in gamma-secretase function

    • The cytosolic loop region influences proteolytic activity

    • C-terminal residues are critical for complex stability

    • Systematically map residues involved specifically in pathogen response vs. gamma-secretase function

  • Rational mutation design:

    • Target residues conserved in one function but not the other

    • Create subtle mutations that maintain protein stability but alter specific interactions

    • Design compensatory mutations that rescue one function while disrupting the other

  • Validation approaches:

    • Assess mutants for complementation of pen2 defense phenotypes

    • Test gamma-secretase activity with in vitro assays

    • Analyze protein-protein interactions with both sets of partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.