Arabidopsis thaliana Probable Gamma-Secretase Subunit PEN-2 (At5g09310) is a protein that is believed to be a subunit of the gamma-secretase complex in Arabidopsis thaliana, also known as thale cress . Gamma-secretase is an endoprotease complex, which cleaves integral membrane proteins within the membrane .
The recombinant protein consists of 146 amino acids . The protein includes a His-tag, which is used for purification purposes .
| Property | Value |
|---|---|
| Amino Sequence | MEATRSDDPSLNPIRNRNPNPNPNPNPLSTIISSAQVWPTIDGPLGLTEEASVDYARRFYKFGFALLPWLWFVNCFYFWPVLRHSRAFPQIRNYVVRSAIGFSVFTALLSAWALTFSIGGEQLFGPLYDKLVMYNVADRLGLSGLA |
PEN-2 is essential for gamma-secretase complex stability and trafficking . The gamma-secretase complex is crucial in various signaling pathways. It plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels .
Recombinant At5g09310 is produced in E. coli . The protein is available from multiple commercial sources . It is usually supplied as a lyophilized powder and needs to be reconstituted in sterile water or a suitable buffer .
Recombinant At5g09310 is used in biochemical and biophysical studies . Some applications include:
Probable subunit of the γ-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
What is the function of PEN-2 in Arabidopsis thaliana?
PEN-2 (PENETRATION2) in Arabidopsis thaliana serves dual roles in plant biology. It functions as an essential component of the gamma-secretase complex, a multisubunit proteolytic complex that requires all four components (presenilin, nicastrin, Aph-1, and Pen-2) for proper activity . Simultaneously, PEN-2 acts as a central component in plant immunity, particularly in cell wall-based defense against non-adapted pathogens like the powdery mildew Blumeria graminis fsp. hordei (Bgh) .
For researchers investigating PEN-2 function, several methodological approaches are recommended:
Generate knockout or knockdown mutants to assess phenotypic changes in both defense responses and developmental processes
Employ fluorescent protein tagging to visualize subcellular localization during infection and normal growth
Use co-immunoprecipitation assays to identify interaction partners in both gamma-secretase and defense pathways
Implement complementation studies with specific domain mutations to identify critical functional regions
How is the structure of Arabidopsis PEN-2 organized?
Arabidopsis PEN-2 exhibits a highly conserved structure with critical functional domains. The protein comprises lumenal N- and C-termini, two transmembrane domains (TMDs), and a cytosolic loop region . Glycosylation studies have confirmed this topology . The first TMD interacts with TMD4 of presenilin (PS1) and is localized to a water-accessible pore . The cytosolic loop region is accessible from the lumenal side via a hydrophilic cavity and may interact with PS1-CTF .
The C-terminal region is particularly important for gamma-secretase complex stability, while an endoplasmic retention signal sequence in TMD1 appears critical for trafficking . PEN-2's remarkable sequence conservation between Homo sapiens and Arabidopsis thaliana suggests fundamental functional importance .
For structural studies, researchers should consider:
Implementing systematic mutagenesis of conserved residues across different domains
Using topology mapping with site-specific labeling techniques
Employing glycosylation site insertion to confirm membrane orientation
Conducting deletion analysis to identify minimal functional domains
What expression systems are optimal for recombinant Arabidopsis PEN-2?
For efficient expression of functional recombinant Arabidopsis PEN-2, insect cell-based systems have proven most effective. A baculovirus expression system in Sf9 host cells allows for the simultaneous expression of all four gamma-secretase components (presenilin, nicastrin, Aph-1, and Pen-2) from a single plasmid . This approach ensures 100% co-infection and co-expression of all components, critical for studying the assembled complex .
The methodological workflow includes:
Subcloning all four gamma-secretase components into a single expression vector
Generating recombinant baculovirus for infection of Sf9 cells
Optimizing expression conditions (temperature, infection time, MOI)
Implementing appropriate detergent-based extraction protocols to maintain complex integrity
Employing affinity purification with tags that minimally impact function
This system provides a powerful tool for in vitro studies of the putative proteolytic function of recombinant Arabidopsis gamma-secretase .
How does PEN-2 interact with other proteins in defense pathways?
PEN-2 functions within a sophisticated network of proteins involved in plant immunity. In defense responses, PEN-2 works coordinately with PEN1 (a syntaxin) and PEN3 (an ABC transporter) to provide resistance against non-adapted pathogens . Loss-of-function mutations in any of these three genes cause decreased hypersensitive cell death triggered by recognition of effectors from oomycete and bacterial pathogens, with considerable additive effects when mutations are combined .
For studying these interactions:
Generate and characterize single, double, and triple mutant combinations
Employ co-localization studies during pathogen infection
Use bimolecular fluorescence complementation to confirm direct interactions
Implement genetic complementation with domain-swapped chimeric proteins
What is the relationship between PEN-2 and indole glucosinolate metabolism?
PEN-2 plays a critical role in the metabolism of indole glucosinolates (IGs), which are important antimicrobial compounds in Arabidopsis. The biosynthesis pathway begins with CYP79B2 and CYP79B3 converting tryptophan (Trp) into indole-3-acetaldoxime (IAOx) . This precursor is then converted into several compounds for antimicrobial immunity, including PEN2 substrates indole-glucosinolates (IGs) .
PEN-2 functions as an atypical myrosinase that hydrolyzes these IGs into bioactive compounds with antimicrobial activity . The cyp79B2 cyp79B3 double mutant, which cannot produce IGs, shows extreme susceptibility to pathogens like Alternaria brassicicola (Ab) . In contrast, the pen2 mutation alone has little effect on resistance to Ab in the Col-0 accession, suggesting pathogen-specific roles for PEN-2-mediated IG metabolism .
For researchers studying this pathway:
Implement targeted metabolite profiling to quantify IG derivatives in different genetic backgrounds
Use LC-MS/MS to monitor changes in metabolite profiles during infection
Combine mutations in biosynthetic and metabolic genes to dissect pathway contributions
Employ enzyme assays with recombinant PEN-2 and purified substrates
How do mutations in PEN-2 affect gamma-secretase complex stability and function?
Systematic mutagenesis studies have revealed domain-specific effects of PEN-2 mutations on gamma-secretase function . The effects vary significantly depending on the mutation location:
| Mutation Region | Effect on PS1 Endoproteolysis | Effect on Proteolytic Activity | Effect on Complex Stability |
|---|---|---|---|
| First half of TMD1 | Decreased | Decreased | Minimal effect |
| Second half of TMD1 | Minimal effect | Increased | Minimal effect |
| Cytosolic loop | Minimal effect | Decreased | Variable effects |
| TMD2 | Decreased | Variable effects | Minimal effect |
| First half of TMD2 | Minimal effect | Decreased | Minimal effect |
| C-terminal residues | Minimal effect | Decreased | Decreased |
Specific mutations of interest include:
N33A in TMD1: Increases gamma-secretase complexes at the cell surface and modestly decreases stability
I53A in the loop region: Reduces stability 10-fold and proteolytic activity by half
E4R, E9A, L12A, L14A, R16A, and K17A in the N-terminal region: Increase the PS1-CTF:Pen-2 ratio, primarily by reducing Pen-2 stability rather than increasing endoproteolysis
Notably, minor PS1 endoproteolysis can occur in the complete absence of Pen-2, suggesting that rather than solely being a catalyst for endoproteolysis, Pen-2 may stabilize the complex prior to PS1 endoproteolysis, allowing time for full assembly and proper trafficking .
What methodologies are most effective for studying PEN-2's role in hypersensitive response (HR)?
To effectively study PEN-2's role in the hypersensitive response, researchers should implement an integrated approach combining genetic, cellular, and biochemical methods:
Genetic approaches:
Generate higher-order mutants combining pen2 with other immunity pathway mutants
Create pen2 mutants in different Arabidopsis accessions to assess genetic background effects
Develop tissue-specific or inducible pen2 knockdown lines to separate developmental from defense functions
Cellular and microscopic techniques:
Use live-cell imaging with fluorescently-tagged PEN-2 to track subcellular localization during pathogen attack
Implement trypan blue staining to quantify cell death responses
Employ ion leakage measurements as a quantitative proxy for HR
Pathogen challenge assays:
Challenge plants with diverse pathogens with different lifestyles (biotrophs, necrotrophs, hemibiotrophs)
Use pathogens expressing different effectors to assess specificity
Monitor infection at different timepoints to capture dynamic responses
Comparative analysis of different pen mutants reveals a complex picture. The pen2 pen3 and pen1 pen3 double mutants show almost complete abolishment of HR induced by AvrRpm1, while surprisingly displaying varying degrees of run-away cell death in response to Bgh . This indicates complex, pathogen-specific roles for PEN proteins that extend beyond their previously recognized functions in cell wall-based defense .
How can chromatin immunoprecipitation techniques be optimized for studying PEN-2 regulation during stress responses?
Understanding the transcriptional regulation of PEN-2 during stress responses requires optimized chromatin immunoprecipitation (ChIP) techniques:
Sample preparation optimization:
IP optimization:
Analysis approaches:
Recent research suggests chromatin contacts are significantly associated with Pol II activities at the gene level and undergo dynamic changes during stress responses . For example, during cold treatment (3-h and 12-h at 4°C), chromatin dynamics were coupled with transcriptional reprogramming . These techniques could reveal similar regulatory mechanisms for PEN-2 during pathogen stress.
What are the most effective strategies for engineering enhanced PEN-2 function in crop plants?
Engineering enhanced PEN-2 function in crop plants for improved disease resistance requires strategic approaches:
Structure-function optimization:
Use site-directed mutagenesis to enhance substrate affinity or catalytic efficiency based on the Arabidopsis model
Create chimeric proteins combining domains from PEN-2 homologs with different substrate preferences
Optimize protein stability while maintaining function through targeted amino acid substitutions
Expression optimization:
Select tissue-specific or pathogen-inducible promoters to minimize fitness costs
Use synthetic promoters with optimized regulatory elements for rapid response to pathogen detection
Implement precise gene editing rather than overexpression to maintain native regulatory control
Pathway engineering:
Co-engineer upstream enzymes (CYP79B2/B3) to ensure substrate availability
Modify transporters to optimize localization of bioactive compounds
Consider engineering downstream metabolic enzymes to prevent accumulation of potentially toxic intermediates
Validation strategies:
Perform infection assays with multiple agriculturally relevant pathogens
Assess potential trade-offs between enhanced immunity and growth/yield
Test in multiple environmental conditions to ensure robust function
Research shows that PEN-2 function extends beyond single pathogen resistance, as mutations affect responses to diverse pathogens including powdery mildew, oomycetes, and bacterial pathogens . This broad-spectrum functionality makes PEN-2 an attractive target for crop improvement.
How can structural modeling inform mutations that dissociate PEN-2's dual roles in immunity and gamma-secretase function?
Structural modeling approaches can help dissociate PEN-2's dual roles through informed mutational strategies:
Homology modeling techniques:
Generate models based on related proteins with known structures
Use evolutionary conservation patterns across species to identify functionally important residues
Implement molecular dynamics simulations to identify conformational flexibility
Functional domain mapping:
Rational mutation design:
Target residues conserved in one function but not the other
Create subtle mutations that maintain protein stability but alter specific interactions
Design compensatory mutations that rescue one function while disrupting the other
Validation approaches:
Assess mutants for complementation of pen2 defense phenotypes
Test gamma-secretase activity with in vitro assays
Analyze protein-protein interactions with both sets of partners