Recombinant Arabidopsis thaliana Probable glycerol-3-phosphate acyltransferase 2 (GPAT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPAT2; At1g02390; T6A9.17; T6A9.8; Probable glycerol-3-phosphate acyltransferase 2; AtGPAT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GPAT2
Target Protein Sequence
MSGNKISTLQALVFFLYRFFILRRWCHRSPKQKYQKCPSHGLHQYQDLSNHTLIFNVEGA LLKSNSLFPYFMVVAFEAGGVIRSLFLLVLYPFISLMSYEMGLKTMVMLSFFGVKKESFR VGKSVLPKYFLEDVGLEMFQVLKRGGKRVAVSDLPQVMIDVFLRDYLEIEVVVGRDMKMV GGYYLGIVEDKKNLEIAFDKVVQEERLGSGRRLIGITSFNSPSHRSLFSQFCQEIYFVRN SDKKSWQTLPQDQYPKPLIFHDGRLAVKPTPLNTLVLFMWAPFAAVLAAARLVFGLNLPY SLANPFLAFSGIHLTLTVNNHNDLISADRKRGCLFVCNHRTLLDPLYISYALRKKNMKAV TYSLSRLSELLAPIKTVRLTRDRVKDGQAMEKLLSQGDLVVCPEGTTCREPYLLRFSPLF SEVCDVIVPVAIDSHVTFFYGTTASGLKAFDPIFFLLNPFPSYTVKLLDPVSGSSSSTCR GVPDNGKVNFEVANHVQHEIGNALGFECTNLTRRDKYLILAGNNGVVKKK
Uniprot No.

Target Background

Function
This protein esterifies acyl groups from acyl-ACP to the sn-1 position of glycerol-3-phosphate, a crucial step in glycerolipid biosynthesis.
Database Links

KEGG: ath:AT1G02390

STRING: 3702.AT1G02390.1

UniGene: At.27394

Protein Families
GPAT/DAPAT family
Subcellular Location
Membrane; Multi-pass membrane protein. Note=Not mitochondrial.
Tissue Specificity
Weakly or not expressed in roots, leaves, seedlings, developing siliques and flower buds.

Q&A

What is the basic function of Arabidopsis thaliana GPAT2?

Arabidopsis thaliana GPAT2 (AtGPAT2) is a membrane-bound glycerol-3-phosphate acyltransferase that catalyzes the transfer of a fatty acyl moiety to glycerol-3-phosphate to form lysophosphatidic acid (LPA). This reaction represents the initial step in glycerolipid biosynthesis in extraplastidic compartments of plant cells. Unlike some other members of the GPAT family, GPAT2 is primarily involved in embryonic development pathways . The enzyme belongs to a plant-specific family of GPATs that have evolved distinct functions in membrane lipid synthesis and cuticle formation. To study this enzyme effectively, researchers should understand its position within the broader lipid biosynthesis network and its relationship to other GPAT family members.

How does AtGPAT2 differ structurally and functionally from other GPATs in Arabidopsis?

Arabidopsis thaliana contains multiple GPAT isoforms (at least 8 membrane-bound GPATs) that form a plant-specific family with three distinct clades . While detailed comparative studies between all members are still emerging, GPAT2 differs from other characterized family members in several ways:

  • Unlike GPAT4, GPAT6, and GPAT8 which are bifunctional enzymes possessing both *sn-*2 acyltransferase and phosphatase activities, GPAT2 is believed to function primarily as an acyltransferase

  • GPAT2 appears to be more closely related to GPAT1 in function, as mutations in both genes lead to defective embryonic development

  • In contrast to the cutin-associated GPAT4/6/8 clade and the suberin-associated GPAT5/7 clade, GPAT2 likely functions in a different lipid biosynthetic pathway more directly related to membrane lipid formation

These structural and functional differences reflect the evolutionary divergence of the GPAT family to serve specialized roles in plant development and physiology.

What is the expression pattern of AtGPAT2 in different tissues and developmental stages?

The expression pattern of AtGPAT2 has been investigated using promoter::GUS plants, revealing tissue-specific and developmental stage-dependent expression . Based on available research:

  • GPAT2 shows significant expression during embryonic development, consistent with its critical role in this process

  • Unlike GPAT1, which shows strong expression in pollen and tapetum tissues, GPAT2's expression appears more concentrated in embryonic tissues

  • Expression patterns may vary throughout plant development, with potential upregulation during critical developmental transitions

For comprehensive expression profiling, researchers should employ both promoter-reporter constructs and quantitative RT-PCR across multiple tissues and developmental stages.

Where is AtGPAT2 subcellularly localized and how does this impact its function?

AtGPAT2, like other membrane-bound GPATs in Arabidopsis, contains transmembrane domains that determine its subcellular localization . Current evidence suggests:

  • GPAT2 is likely localized to mitochondrial membranes, as indicated by its classification as a "mitochondrial GPAT"

  • This mitochondrial localization distinguishes it from other GPAT family members that localize to the endoplasmic reticulum or other cellular compartments

  • The mitochondrial localization is functionally significant, as it positions GPAT2 to participate in the production of mitochondria-specific lipids or to influence mitochondrial membrane composition during embryogenesis

Researchers investigating GPAT2 localization should consider fluorescent protein fusions combined with organelle-specific markers to confirm its precise subcellular distribution.

What are the most effective methods for producing recombinant AtGPAT2 protein?

Based on approaches used with other GPAT family members, recombinant AtGPAT2 can be produced using several expression systems:

  • Yeast Expression System:

    • The gat1Δ yeast mutant strain (e.g., BY4742, Matα, his3C1, leu2C0, lys2C0, ura3C0, YKR067w::kanMX4) has been successfully used for heterologous expression of Arabidopsis GPATs

    • Cloning the AtGPAT2 cDNA into a yeast expression vector (such as pYES2.1/V5-His-TOPO) under a galactose-inducible promoter

    • Culture conditions: 30°C in YPD medium containing 1% Bacto-yeast extract, 2% Bacto-peptone, and 2% glucose, with expression induced by transferring to galactose-containing medium

  • Alternative Expression Systems:

    • Wheat germ cell-free expression system, which has been successfully used for other GPATs like GPAT6

    • E. coli expression systems with specialized modifications to accommodate membrane proteins

    • Baculovirus-insect cell expression for higher eukaryotic protein processing capabilities

For optimal activity, purification should employ gentle detergent solubilization methods that maintain the integrity of transmembrane domains essential for enzymatic function.

What are the recommended approaches for assessing AtGPAT2 enzymatic activity?

Enzymatic activity of recombinant AtGPAT2 can be assessed using established protocols for GPAT family members:

  • Standard GPAT Activity Assay:

    • Reaction mixture containing purified recombinant AtGPAT2, [14C]glycerol-3-phosphate, and various acyl-CoA substrates

    • Incubation at optimal temperature (typically 30°C) for a defined period

    • Extraction of lipid products and separation by thin-layer chromatography

    • Quantification of radiolabeled products using scintillation counting or phosphorimaging

  • Substrate Preference Analysis:

    • Testing various acyl-CoA substrates of different chain lengths (C16-C24)

    • Comparing activity with unmodified fatty acyl-CoAs versus ω-oxidized derivatives

    • Measuring the relative rates of product formation for each substrate type

  • Product Analysis:

    • Determining whether GPAT2 produces predominantly *sn-*1 or *sn-*2 LPA

    • Investigating whether GPAT2 possesses phosphatase activity like GPAT4/6/8 or lacks this activity like GPAT5

    • Using mass spectrometry to identify and quantify the specific lipid products formed

These enzymatic characterizations are essential for understanding GPAT2's specific role in lipid biosynthesis relative to other family members.

What approaches are most effective for studying AtGPAT2 function using genetic disruption?

Several genetic approaches have proven effective for functional characterization of GPAT family members:

  • T-DNA Insertion Mutants:

    • Screening T-DNA insertion collections (such as those available at the Arabidopsis Knockout Facility) using PCR with gene-specific and T-DNA border primers

    • Confirming insertion sites by sequencing PCR products and verifying transcript disruption via RNA gel blot analysis

    • Analyzing single mutants and generating double mutants with related GPATs to address potential functional redundancy

  • CRISPR/Cas9 Gene Editing:

    • Designing sgRNAs targeting specific regions of the AtGPAT2 coding sequence

    • Creating precise mutations or larger deletions to study structure-function relationships

    • Generating conditional knockouts if complete loss of function is embryonic lethal

  • RNAi and Artificial microRNA Approaches:

    • Useful for tissue-specific or inducible knockdown when studying genes with essential functions

    • May help overcome embryonic lethality issues associated with GPAT2 disruption

When analyzing gpat2 mutants, researchers should carefully examine embryo development using microscopy techniques and compare phenotypes with other lipid biosynthesis mutants to establish pathway relationships.

How can researchers distinguish between direct and indirect effects of AtGPAT2 disruption in mutant phenotypes?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Genetic Complementation:

    • Reintroducing wild-type AtGPAT2 under native or inducible promoters to confirm phenotype rescue

    • Creating site-directed mutants to identify specific residues critical for function

    • Expressing AtGPAT2 from related species to assess functional conservation

  • Temporal and Spatial Analysis:

    • Using inducible knockout or knockdown systems to determine when GPAT2 activity is required

    • Employing tissue-specific promoters to restrict genetic manipulation to specific cell types

    • Correlating expression patterns with the emergence of phenotypes in mutant lines

  • Biochemical Validation:

    • Conducting comprehensive lipidomic analyses to identify specific lipid species altered in mutants

    • Measuring LPA and downstream lipid intermediates to establish direct metabolic consequences

    • Performing in vitro enzymatic assays with subcellular fractions from mutant plants

  • Multi-omics Approaches:

    • Combining transcriptomics, proteomics, and metabolomics to differentiate primary from secondary effects

    • Establishing temporal relationships between gene expression changes and metabolic alterations

What is known about the substrate specificity of AtGPAT2?

While detailed biochemical characterization of AtGPAT2 specifically is limited in the provided search results, inferences can be made based on other GPAT family members:

  • Acyl-CoA Preferences:

    • Other GPATs in Arabidopsis show differential preferences for acyl-CoA substrates of varying chain lengths and modifications

    • GPAT2 may exhibit preferences for specific fatty acyl-CoA donors based on its functional role in embryonic development

    • Since it functions in embryo development, GPAT2 likely utilizes common cellular fatty acids (C16-C18) rather than specialized very-long-chain fatty acids used by suberin-associated GPATs

  • Regiospecificity:

    • Many plant GPATs exhibit *sn-*2 regiospecificity, unlike membrane/storage lipid GPATs with *sn-*1 regiospecificity

    • The regiospecificity of GPAT2 should be experimentally determined to understand its role in the biosynthetic pathway

  • Potential Phosphatase Activity:

    • Some GPATs (GPAT4/6/8) possess dual acyltransferase and phosphatase activities, while others (GPAT5) lack phosphatase activity

    • Whether GPAT2 possesses phosphatase activity would significantly influence its metabolic products and pathway positioning

Researchers should conduct comprehensive substrate screening with both conventional and oxidized acyl-CoAs of various chain lengths to fully characterize GPAT2's substrate profile.

How does AtGPAT2 activity integrate with broader lipid metabolism networks during embryogenesis?

GPAT2's activity fits into a complex network of lipid metabolism particularly critical during embryogenesis:

  • Metabolic Pathway Integration:

    • GPAT2-derived LPA serves as a precursor for PA formation through the action of LPAAT enzymes

    • PA is a central intermediate that can be channeled into phospholipid synthesis or converted to diacylglycerol for neutral lipid production

    • The mitochondrial localization of GPAT2 suggests potential involvement in mitochondria-specific lipid production

  • Embryo-Specific Lipid Requirements:

    • Embryogenesis requires precise coordination of membrane biogenesis for rapid cell division

    • GPAT2 likely contributes to the production of specific membrane lipids essential for embryonic development

    • Mutations in GPAT2 and GPAT1 lead to defective embryonic development, highlighting the non-redundant roles of these enzymes

  • Regulatory Mechanisms:

    • GPAT2 activity may be regulated by developmental cues specific to embryogenesis

    • Coordination with other enzymes in the pathway likely occurs through transcriptional, post-transcriptional, and post-translational mechanisms

    • Cross-talk between lipid metabolism and hormone signaling pathways may influence GPAT2 function

Understanding these intricate relationships requires systems biology approaches combining genetics, biochemistry, and advanced imaging techniques.

How can GPAT2 research contribute to understanding plant adaptation to environmental stresses?

Though primarily associated with embryonic development, GPAT2 research can offer insights into plant stress adaptation:

  • Membrane Lipid Remodeling:

    • Environmental stresses often trigger membrane lipid composition changes

    • Understanding how GPAT2 activity responds to stress conditions may reveal roles in adaptive membrane remodeling

    • Conditional expression of GPAT2 under stress could be investigated using quantitative expression analyses

  • Metabolic Flexibility:

    • Plants adjust lipid metabolism during stress responses

    • GPAT2's position at a branch point in lipid metabolism may make it a regulatory target during stress adaptation

    • Investigation of GPAT2 expression and activity under various stresses (temperature, drought, salinity) could reveal unexpected roles

  • Mitochondrial Function Under Stress:

    • As a mitochondrial GPAT, GPAT2 may influence mitochondrial membrane composition during stress

    • Mitochondrial function is critical for energy homeostasis during stress responses

    • Research linking GPAT2 activity to mitochondrial performance under stress could yield valuable insights

These investigations would expand GPAT2 research beyond its developmental role toward broader plant physiological adaptations.

What are the implications of AtGPAT2 research for metabolic engineering applications?

AtGPAT2 research has several potential applications in metabolic engineering:

  • Enhanced Embryo Development:

    • Optimization of GPAT2 expression might improve embryo viability in challenging conditions

    • Engineering GPAT2 variants with altered regulatory properties could enhance seed development

    • Applications in improving embryogenesis in hybrid crosses or wide crosses between species

  • Mitochondrial Membrane Engineering:

    • Manipulating GPAT2 activity could allow targeted modification of mitochondrial membrane properties

    • Potential applications in improving mitochondrial function under stress conditions

    • Engineering mitochondrial membranes with altered fatty acid compositions for improved energetics

  • Pathway Flux Control:

    • GPAT2 represents a control point for directing glycerolipid synthesis

    • Balancing GPAT2 activity with other lipid metabolic enzymes could optimize desired lipid production

    • Co-expression with complementary enzymes might allow engineering of specific lipid profiles

These applications extend beyond basic understanding of GPAT2 function to practical biotechnological implementations.

What are the major challenges in expressing and purifying functional recombinant AtGPAT2?

Researchers face several challenges when working with recombinant GPAT2:

  • Membrane Protein Expression Challenges:

    • As a membrane-bound enzyme with transmembrane domains, GPAT2 can be difficult to express in soluble, active form

    • Protein misfolding, aggregation, or incorrect membrane insertion often occur in heterologous systems

    • Solution: Use specialized expression systems like yeast gat1Δ mutants that have been successful for other GPATs , or utilize cell-free expression systems with appropriate membrane mimetics

  • Activity Preservation During Purification:

    • Transmembrane domains are essential for proper GPAT2 function

    • Harsh detergents can denature the protein or disrupt activity

    • Solution: Employ gentle solubilization with mild detergents or nanodiscs to maintain native-like membrane environment

  • Stability Issues:

    • Membrane proteins often exhibit limited stability after purification

    • Activity may decrease rapidly during storage

    • Solution: Optimize buffer conditions with appropriate lipids and cryoprotectants; consider using crude membrane fractions for activity assays rather than purified protein

These technical challenges require methodological optimizations specific to GPAT2's biochemical properties.

How can researchers effectively analyze the complex lipid profiles resulting from AtGPAT2 activity?

Modern lipidomic approaches enable comprehensive analysis of GPAT2-related lipid profiles:

  • Advanced Analytical Techniques:

    • Liquid chromatography coupled with high-resolution mass spectrometry (LC-HRMS) for comprehensive lipidomic profiling

    • Multiple reaction monitoring (MRM) for targeted analysis of specific lipid species

    • Ion mobility-mass spectrometry for separation of isobaric lipid species

  • Specialized Extraction Protocols:

    • Modified Bligh and Dyer or MTBE extraction methods optimized for LPA and PA recovery

    • Sequential extraction procedures to separate different lipid classes

    • Internal standards for accurate quantification of low-abundance intermediates

  • Data Analysis Approaches:

    • Multivariate statistical methods to identify subtle lipid profile changes

    • Pathway mapping tools to visualize metabolic shifts

    • Integration of lipidomic data with transcriptomic or proteomic datasets

  • In Situ Lipid Analysis:

    • MALDI-imaging mass spectrometry for spatial distribution of lipids in embryonic tissues

    • Fluorescent lipid probes for live-cell imaging of lipid dynamics

    • Correlation of lipid distribution with GPAT2 expression patterns

These advanced analytical approaches provide deeper insights into GPAT2's metabolic impact than traditional lipid analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.