Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana Probable inactive receptor kinase At3g02880, also known as KIN7, is a membrane-localized leucine-rich repeat (LRR) kinase that interacts with and regulates transmembrane transporters . It is also referred to as QSK1, or qiān shŏu, which translates from Chinese to "thousand hands" kinase .

Gene and Protein Information

The gene encoding At3g02880 is located on chromosome 3 of Arabidopsis thaliana . The protein is a receptor kinase with a short extracellular domain . The protein sequence for Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880) is presented in the table below :

FeatureDescription
Recommended NameProbable inactive receptor kinase At3g02880
Gene NamesAt3g02880
Ordered Locus NamesAt3g02880
ORF NamesF13E7.17
Expression Region24-627
Amino Acid SequenceSDLESDRRALLAVRNSVRGRPLLWNMSASSPCNWHGVHCDAGRVTALRLPGSGLFGSLPIGGIGNLTQLKTLSLRFNSLSGPIPSDFSNLVLLRYLYLQGNAFSGEIPSLLFTLPSIIRINLGENKFSGRIPDNVNSATRLVTLYLERNQLSGPIPEITLPLQQFNVSSNQLNGSIPSSLSWPRTAFEGNTLCGKPLDTCEAESPNGGDAGGPNTPPEKKDSDKLSAGAIVGIVIGCVVGLLLLLLILFCLCRKRKKEENVPSRNVEAPVAAATSSAAIPKETVVVVPPAKATGSESGAVNKDLTFFVKSFGEFDLDGLLKASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKEFRERLHVLGSMSHANLVTLIAYYFSRDEKLLVFEYMSKGSLSAILHGNKGNGRTPLNWETRAGIALGAARAISYLHSRDGTTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEITDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEVSHSSGSPNPVSD

Function and Regulation

At3g02880 (QSK1) modulates the activity of Sucrose-Induced Receptor Kinase 1 (SIRK1) in response to external sucrose stimulation . Specifically, upon sucrose stimulation, SIRK1 forms a complex with QSK1 . SIRK1 autophosphorylates at Ser-744 following sucrose treatment, and then interacts with and transphosphorylates QSK1 and QSK2 . QSK1 stabilizes and enhances SIRK1 activity and recruits substrate proteins, like aquaporins . Mutants lacking QSK1 and QSK2 exhibit reduced water influx rates under iso-osmotic sucrose stimulation, which confirms their involvement in the same signaling pathway as SIRK1 .

The localization of QSK1 within the plasma membrane depends on cytoskeleton integrity . Disruption of actin filaments leads to a depletion of QSK1 from detergent-resistant membrane fractions and an increase in detergent-soluble fractions . Disruption of microtubules results in a uniform localization and is accompanied by internalization processes or reduced secretion .

Role in Abiotic Stress Response

Receptor Dead Kinase1 (RDK1) is another leucine-rich repeat-RLK gene in Arabidopsis thaliana and is induced by abscisic acid (ABA) . RDK1 interacts with type 2C protein phosphatase ABSCISIC ACID INSENSITIVE1 (ABI1) in the plasma membrane, and this interaction is enhanced by ABA . RDK1-mediated recruitment of ABI1 onto the plasma membrane is important for ABA signaling and plant responses to abiotic stress conditions in an ABA-dependent manner . RDK1, or its function, may relate to At3g02880.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
At3g02880; F13E7.17; Probable inactive receptor kinase At3g02880
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-627
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g02880
Target Protein Sequence
SDLESDRRALLAVRNSVRGRPLLWNMSASSPCNWHGVHCDAGRVTALRLPGSGLFGSLPI GGIGNLTQLKTLSLRFNSLSGPIPSDFSNLVLLRYLYLQGNAFSGEIPSLLFTLPSIIRI NLGENKFSGRIPDNVNSATRLVTLYLERNQLSGPIPEITLPLQQFNVSSNQLNGSIPSSL SSWPRTAFEGNTLCGKPLDTCEAESPNGGDAGGPNTPPEKKDSDKLSAGAIVGIVIGCVV GLLLLLLILFCLCRKRKKEENVPSRNVEAPVAAATSSAAIPKETVVVVPPAKATGSESGA VNKDLTFFVKSFGEFDLDGLLKASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEK EFRERLHVLGSMSHANLVTLIAYYFSRDEKLLVFEYMSKGSLSAILHGNKGNGRTPLNWE TRAGIALGAARAISYLHSRDGTTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNR IDGYRAPEITDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTEQQ TPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEVSHSSGSPN PVSD
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G02880

STRING: 3702.AT3G02880.1

UniGene: At.24310

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At3g02880 and what are its known alternative names?

At3g02880 is a gene in Arabidopsis thaliana that encodes a probable inactive receptor kinase. This protein has several alternative names in the scientific literature, including KIN7 and QSK1 . It belongs to a class of proteins that, despite being structurally similar to active kinases, may lack or have reduced catalytic activity while retaining important signaling functions. At3g02880 is part of the receptor-like kinase family, which plays crucial roles in plant signaling pathways related to development and stress responses .

The full recombinant protein is available commercially with specifications as follows:

Catalog NumberProduct NameSourceSpeciesTagProtein Length
RFL8786AFRecombinant Full Length Arabidopsis Thaliana Probable Inactive Receptor Kinase At3G02880E. coliArabidopsis thalianaHisFull Length of Mature Protein (24-627)

What is the function of At3g02880 (KIN7/QSK1) in Arabidopsis?

At3g02880 (KIN7/QSK1) has been implicated in several important physiological processes in Arabidopsis. Current research indicates that KIN7 plays a significant role in regulating stomatal closure by modulating the vacuolar TPK1 K+ channel . Additionally, as QSK1, it has been investigated for its role in the regulation of aquaporins, suggesting a function in water transport and homeostasis .

Furthermore, recent studies indicate that many receptor-like kinases, including those that may be catalytically inactive, have significant noncatalytic functions in plant immune signaling . These proteins can function as scaffolds, allosteric regulators, or competitive inhibitors in signaling pathways, allowing them to influence cellular processes even without direct catalytic activity. The specific molecular mechanisms through which At3g02880 functions are still being investigated, with particular interest in its potential roles in abscisic acid (ABA) signaling and stress responses .

How is At3g02880 related to other receptor-like kinases in plants?

At3g02880 (KIN7/QSK1) belongs to a subclass of receptor-like kinases that can include catalytically inactive members. While the search results don't explicitly classify At3g02880 within specific subgroups, research on receptor-like cytoplasmic kinases (RLCKs) in Arabidopsis shows that some members of subgroup VIII RLCKs lack catalytic protein kinase activity but still play important roles in immune signaling . These proteins often function through protein-protein interactions and can have redundant roles with their paralogs.

In particular, search result indicates that QSK1 (At3g02880) has been studied alongside QSK2 (At5g16590), suggesting these proteins may have related or complementary functions in plant cells. Similarly, KIN7 has been studied in relation to LRR1, with researchers creating double mutants to investigate their combined effects .

What genetic resources are available for studying At3g02880 function?

Several genetic resources are available for researchers interested in studying At3g02880 function:

  • T-DNA insertion lines: The KIN7 (At3g02880) T-DNA insertion line SALK_001905 (kin7) is available from the European Arabidopsis Inventory Center . This mutant line provides an excellent resource for loss-of-function studies.

  • Double mutants: Researchers have constructed double mutants such as lrr1kin7 by crossing single mutants (lrr1-1 and kin7) . These resources are valuable for studying potential genetic interactions and redundancies.

  • Overexpression lines: While not specifically mentioned for At3g02880 in the search results, overexpression approaches are commonly used in Arabidopsis research and could be applied to this gene as well.

For genotyping these lines, specific primers can be designed based on the T-DNA insertion site. Standard protocols for genotyping T-DNA insertion lines in Arabidopsis involve PCR using a combination of gene-specific primers and T-DNA border primers .

What experimental approaches are recommended for protein-protein interaction studies with At3g02880?

Based on the search results, several approaches have been successfully used to study protein-protein interactions involving At3g02880 (KIN7/QSK1):

  • Pull-down experiments: Using SIRK1-GFP or QSK1-GFP as bait proteins to identify interacting partners . This approach allows for the identification of protein complexes in which At3g02880 participates.

  • In vitro phosphorylation assays: Using purified recombinant QSK1 and SIRK1 kinase domains and synthetic peptides as phosphorylation targets . This approach can help determine whether At3g02880 has kinase activity toward specific substrates.

  • Comparative phosphoproteomic analysis: This approach was used to analyze wild type, qsk1 mutant, sirk1 mutant, and sirk1 qsk1 double mutant plants under different conditions (sucrose starvation and sucrose resupply) . Such analyses can reveal the impact of At3g02880 on the phosphorylation status of other proteins in the cell.

  • Recombinant protein production: Production of recombinant full-length At3g02880 protein (with His-tag) in E. coli systems has been reported , providing a resource for in vitro biochemical studies.

For these experiments, it is crucial to include appropriate controls and perform at least three biological replicates per genotype to ensure statistical robustness .

How can I analyze the expression patterns of At3g02880?

To analyze the expression patterns of At3g02880, several approaches can be employed:

  • RNA extraction and RT-PCR: Total RNA can be extracted from seedlings using commercial RNA extraction kits (e.g., Tiangen, Beijing, China) followed by DNase I treatment and reverse transcription. The expression of At3g02880 can then be compared across different samples, using reference genes like ACTIN2 for normalization .

  • Promoter-reporter constructs: The promoter region of At3g02880 can be cloned into a reporter vector (such as GUS expression vector pCAMBIA1381) and transformed into Arabidopsis. This allows visualization of the spatial and temporal expression patterns in different tissues and developmental stages .

  • Large-scale transcriptome analysis: Approaches like EXPLICIT-Kinase can be used to analyze At3g02880 expression patterns in relation to other genes across thousands of transcriptome datasets. This method has been used to predict the expression of 30,172 non-kinase genes based on the expression of 994 protein kinase genes, providing insights into the functional relationships between kinases and their potential targets .

  • Tissue localization studies: For proteins, fluorescent tagging (like GFP fusion) can be used to visualize the subcellular localization of At3g02880 in different tissues .

What is the role of At3g02880 (KIN7) in stomatal regulation?

At3g02880 (KIN7) has been implicated in the regulation of stomatal closure according to search result . The paper titled "KIN7 Kinase Regulates the Vacuolar TPK1 K+ Channel during Stomatal Closure" suggests that KIN7 modulates the activity of the TPK1 potassium channel in the vacuole.

Stomatal closure is a complex process regulated by multiple signals, including abscisic acid (ABA), CO2, and light. It involves ion channel regulation that controls ion fluxes across the guard cell membrane and tonoplast (vacuolar membrane), leading to changes in guard cell turgor and stomatal aperture .

The TPK1 K+ channel is a key component in this process, as it regulates K+ release from the vacuole during stomatal closure. KIN7 appears to regulate TPK1 activity, potentially through phosphorylation, although the exact mechanism isn't fully detailed in the available search results.

This research connects to broader topics in plant physiology, including:

  • Guard cell sensory systems and stomatal responses to environmental stimuli

  • ABA perception and signaling pathways

  • Mechanisms of stomatal aperture control

  • CO2-induced responses in stomata

Further research in this area might involve investigating the specific phosphorylation sites on TPK1 that are targeted by KIN7, the conditions under which this regulation occurs, and how this regulation integrates with other signaling pathways controlling stomatal movements.

How does At3g02880 (QSK1) interact with SIRK1 in sucrose signaling?

The interaction between At3g02880 (QSK1) and SIRK1 (Sucrose-induced Receptor Kinase 1) has been investigated in the context of sucrose signaling and the regulation of aquaporins . Search result indicates that comparative phosphoproteomic analysis was performed on wild type, qsk1 mutant, sirk1 mutant, and sirk1 qsk1 double mutant plants under sucrose starvation and sucrose resupply conditions.

The experimental approaches used to study this interaction included:

  • Pull-down experiments using SIRK1-GFP or QSK1-GFP as bait proteins

  • In vitro phosphorylation assays with purified recombinant QSK1 and SIRK1 kinase domains

  • Use of synthetic peptides as phosphorylation targets

The title of the paper, "Sucrose-induced Receptor Kinase 1 is Modulated by an Interacting..." suggests that QSK1 may modulate the activity or function of SIRK1, potentially through direct interaction or phosphorylation events. This research contributes to our understanding of how plants sense and respond to changes in sucrose availability, which is crucial for energy homeostasis and growth regulation.

What are the noncatalytic functions of At3g02880 and other similar receptor kinases?

Recent research highlights that some receptor-like kinases, despite lacking catalytic activity, play important noncatalytic roles in plant signaling pathways. Search result specifically discusses "catalytically inactive subgroup VIII receptor-like cytoplasmic kinases" in Arabidopsis immune signaling.

Key findings about noncatalytic functions include:

  • Protein-protein interactions: Even without catalytic activity, these proteins can form complexes with other signaling components, functioning as scaffolds or adaptors that facilitate the assembly of signaling complexes .

  • Dimerization: Evidence supports homo- and hetero-dimerization between related kinases (such as CARK7 and MAZ), which may be a general feature of their subgroup. This suggests At3g02880 might also participate in similar interactions .

  • Redundancy in signaling: Genetic analysis suggests redundant roles for related kinases (like MAZ and CARK6) as negative regulators of immune-triggered oxidative burst. This functional redundancy may apply to other processes involving At3g02880 .

  • Complementation without catalytic activity: Mutant variants of related kinases incapable of protein kinase activity can complement corresponding mutants, supporting noncatalytic roles in planta .

These findings suggest that At3g02880, which is described as a "probable inactive receptor kinase," may similarly function through protein-protein interactions, dimerization, and other noncatalytic mechanisms to influence cellular signaling pathways, rather than through direct phosphorylation of substrates.

How can phosphoproteomic data be used to understand At3g02880 function?

Phosphoproteomic analysis is a powerful approach for understanding the function of kinases and their targets. For At3g02880 (QSK1), search result describes a comparative phosphoproteomic analysis conducted on wild type, qsk1 mutant, sirk1 mutant, and sirk1 qsk1 double mutant plants under different conditions.

To effectively use phosphoproteomic data for understanding At3g02880 function:

  • Comparative analysis: Compare phosphorylation patterns between wild type and qsk1 mutant plants to identify proteins whose phosphorylation status changes in the absence of QSK1. These could be direct or indirect targets of QSK1-mediated signaling.

  • Condition-dependent changes: Analyze how phosphorylation patterns change under different conditions (e.g., sucrose starvation vs. sucrose resupply) to understand the context-specific functions of QSK1.

  • Network analysis: Integrate phosphoproteomic data with protein-protein interaction data and gene expression data to construct signaling networks involving QSK1.

  • Motif analysis: Identify common phosphorylation motifs among proteins affected by QSK1 to understand its substrate specificity (if it has catalytic activity) or the specificity of kinases it regulates.

  • Validation experiments: Use in vitro phosphorylation assays with purified recombinant QSK1 and potential substrates identified from phosphoproteomic data to validate direct interactions.

When designing phosphoproteomic experiments, it's crucial to include at least three biological replicates per genotype to ensure statistical robustness .

How can the EXPLICIT-Kinase approach be applied to predict At3g02880 functions?

The EXPLICIT-Kinase approach is a powerful method for predicting the functions of protein kinases based on their expression patterns and relationships with other genes. As described in search result , this approach can be applied to At3g02880 in the following ways:

  • Expression prediction model: EXPLICIT-Kinase uses a universal gene expression predictor for Arabidopsis that can predict the expression of 30,172 non-kinase genes based on the expression of 994 protein kinase genes. This model can help identify genes whose expression patterns correlate with At3g02880 .

  • Identification of predictor kinases: The model can identify "predictor kinases" for specific genes and pathways. If At3g02880 is identified as a predictor kinase for certain genes or pathways, this suggests a regulatory role for At3g02880 in those processes .

  • Comparative analysis across species: By comparing predictor kinases between Arabidopsis and other plant species (like maize), conserved functions can be identified. If At3g02880 has orthologs that function as predictor kinases for similar pathways in other species, this strengthens the evidence for its regulatory role .

  • Mathematical framework: The model is based on a linear regression approach represented by the equation Y = XB + ε, where X is the log-transformed expression matrix of kinase genes, Y is the log-transformed expression matrix of non-kinase genes, and B and ε represent the coefficient matrix and random errors, respectively .

This approach is particularly valuable for understanding the functions of kinases like At3g02880 that may not have been extensively characterized through traditional experimental approaches.

What experimental design considerations are important when studying At3g02880 in different genetic backgrounds?

When designing experiments to study At3g02880 (KIN7/QSK1) in different genetic backgrounds, several important considerations should be kept in mind:

  • Genotype verification: Always verify the genotype of mutant lines (like kin7 T-DNA insertion lines) using appropriate PCR-based genotyping methods. Design primers that can distinguish between wild-type and mutant alleles .

  • Controlled growth conditions: Maintain consistent growth conditions (temperature, light/dark cycle, humidity) across all genotypes being compared. In the studies reviewed, plants were typically grown at 22°C with a 14h/10h or 16h/8h light/dark cycle .

  • Multiple alleles or complementation: When possible, use multiple alleles of the gene (different T-DNA insertion lines) or complement the mutant with the wild-type gene to confirm that observed phenotypes are due to the mutation in At3g02880 .

  • Double mutants: Consider creating double mutants with genes suspected to have redundant or interacting functions with At3g02880, such as the lrr1kin7 double mutant described in search result .

  • Biological replicates: Include at least three biological replicates per genotype in all experiments to ensure statistical robustness .

  • Control samples: Always include appropriate controls, such as wild-type plants grown and processed alongside mutant plants.

  • Tissue selection: Be consistent in the tissues selected for analysis, as the expression and function of At3g02880 may vary between different plant tissues and developmental stages.

  • Condition-specific phenotypes: Test multiple conditions (e.g., different stresses, nutrient conditions) as the function of At3g02880 may only be apparent under specific conditions, such as the sucrose starvation and resupply conditions used in search result .

By carefully considering these experimental design factors, researchers can increase the reliability and reproducibility of their studies on At3g02880 function.

What in vitro approaches can be used to test the kinase activity of At3g02880?

Given that At3g02880 is described as a "probable inactive receptor kinase," it's particularly important to directly test its kinase activity. Several in vitro approaches can be used:

  • Recombinant protein production: Express and purify the kinase domain or full-length At3g02880 protein with appropriate tags (e.g., His-tag) in expression systems like E. coli .

  • In vitro kinase assays: Use purified recombinant At3g02880 kinase domain in phosphorylation reactions with:

    • Generic substrates like myelin basic protein or casein

    • Synthetic peptides designed based on consensus phosphorylation motifs

    • Potential physiological substrates identified through phosphoproteomic studies

  • ATP consumption assays: Measure ATP consumption during kinase reactions to quantify kinase activity.

  • Western blotting: Use phospho-specific antibodies to detect phosphorylation of substrates after in vitro kinase reactions.

  • Radiometric assays: Use γ-³²P-ATP in kinase reactions to directly measure incorporation of radioactive phosphate into substrates.

  • Mutational analysis: Create variants with mutations in key catalytic residues to determine whether the observed effects require kinase activity. This approach has been used for related kinases, showing that mutant variants incapable of protein kinase activity can still function in planta, supporting noncatalytic roles .

These approaches, particularly when used in combination, can provide strong evidence regarding the catalytic activity (or lack thereof) of At3g02880 and help distinguish between its catalytic and noncatalytic functions.

How can structural biology approaches contribute to understanding At3g02880 function?

Structural biology approaches can provide valuable insights into the function of At3g02880, particularly given its classification as a "probable inactive receptor kinase." While the search results don't specifically mention structural studies of At3g02880, several approaches could be employed:

These structural approaches, combined with functional studies, can help elucidate whether At3g02880 lacks catalytic activity due to specific structural features and how it might function through protein-protein interactions or other noncatalytic mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.