Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g08680 (At3g08680)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At3g08680; F17O14.15; Probable inactive receptor kinase At3g08680
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-640
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g08680
Target Protein Sequence
ADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNARVTALRLPGSGLYGP LPEKTFEKLDALRIISLRSNHLQGNIPSVILSLPFIRSLYFHENNFSGTIPPVLSHRLVN LDLSANSLSGNIPTSLQNLTQLTDLSLQNNSLSGPIPNLPPRLKYLNLSFNNLNGSVPSS VKSFPASSFQGNSLLCGAPLTPCPENTTAPSPSPTTPTEGPGTTNIGRGTAKKVLSTGAI VGIAVGGSVLLFIILAIITLCCAKKRDGGQDSTAVPKAKPGRSDNKAEEFGSGVQEAEKN KLVFFEGSSYNFDLEDLLRASAEVLGKGSYGTTYKAILEEGTTVVVKRLKEVAAGKREFE QQMEAVGRISPHVNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETR LRICLEAARGISHIHSASGAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSR SLGYRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREE WTGEVFDVELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPG SGNRASSPEMIRSSDSPV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G08680

STRING: 3702.AT3G08680.1

UniGene: At.22405

Protein Families
Protein kinase superfamily, Tyr protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant At3g08680 protein?

When expressing recombinant At3g08680, several expression systems can be considered, each with specific advantages:

Expression SystemAdvantagesConsiderationsRecommended Conditions
E. coli (BL21)High yield, rapid production, cost-effectiveMay lack post-translational modifications18°C induction, OD600 of 0.6-0.8, 0.1-0.5 mM IPTG
Insect cells (Sf9)Better protein folding, some post-translational modificationsMore expensive, longer timeline27°C, 72-96h post-infection
Plant expression (N. benthamiana)Native modifications and folding environmentLower yield, more technically demandingAgrobacterium infiltration, harvest 3-5 days post-infiltration

For solubility enhancement, consider fusion tags such as MBP (maltose-binding protein), GST (glutathione S-transferase), or SUMO, which can significantly improve protein solubility while providing affinity purification options. Inclusion of appropriate protease cleavage sites allows tag removal if necessary for downstream applications.

When designing expression constructs, it's important to note that experiments involving recombinant DNA may be exempt from NIH Guidelines under Section III-F if they meet specific criteria, such as those outlined for eukaryotic host DNA .

What purification strategies yield the highest quality At3g08680 protein for biochemical studies?

A multi-step purification approach is recommended to obtain high-purity At3g08680 protein:

  • Initial capture: Affinity chromatography using the fusion tag (His, GST, or MBP)

    • For His-tagged protein: Ni-NTA resin with imidazole gradient elution (50-250 mM)

    • For GST-tagged protein: Glutathione sepharose with reduced glutathione elution

    • Buffer conditions: 50 mM Tris-HCl pH 8.0, 150-300 mM NaCl, 5% glycerol, 1 mM DTT

  • Intermediate purification: Ion exchange chromatography

    • Anion exchange (Q-sepharose) if pI < 7

    • Cation exchange (SP-sepharose) if pI > 7

    • Salt gradient elution (50-500 mM NaCl)

  • Polishing step: Size exclusion chromatography

    • Superdex 75 or 200 depending on molecular weight

    • Buffer optimization for downstream applications (typically 20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTT)

  • Quality control assessments:

    • SDS-PAGE: >95% purity

    • Western blot: Confirmation of identity

    • Dynamic light scattering: Monodispersity check

    • Thermal shift assay: Protein stability assessment

For kinases specifically, include stabilizing agents like ATP analogs (AMP-PNP) or divalent cations (Mg2+, Mn2+) in purification buffers to enhance protein stability.

How can I design experiments to determine if At3g08680 forms protein complexes in planta?

To investigate potential protein complexes involving At3g08680, a multi-faceted approach is recommended:

  • Co-immunoprecipitation (Co-IP) analysis:

    • Express epitope-tagged At3g08680 in Arabidopsis (native promoter)

    • Perform pull-downs under native conditions

    • Identify interacting partners by mass spectrometry

    • Include appropriate controls (untagged line, IgG control)

  • Split-fluorescent protein complementation:

    • BiFC (Bimolecular Fluorescence Complementation) with potential interactors

    • Subcellular localization analysis of interaction sites

    • Quantification of fluorescence intensity

    • Controls with mutated interaction domains

  • FRET-FLIM (Förster Resonance Energy Transfer-Fluorescence Lifetime Imaging):

    • Higher sensitivity for detecting transient interactions

    • Provides spatial resolution within cells

    • Quantitative measurements of interaction strength

  • Statistical analysis of interaction data:

    • Apply appropriate factorial designs for experiments with multiple variables

    • Use ANOVA to compare interaction strengths across conditions

    • Consider biological replicates and technical replicates separately

Based on studies of similar RLCKs, potential interaction partners to test include calcium-dependent protein kinases (like CPK28), which have been shown to associate with and phosphorylate related RLCKs in planta .

What are the recommended controls for studying At3g08680 knockout or overexpression lines?

Control TypePurposeImplementation
Wild-type controlsBaseline comparisonSame ecotype, grown simultaneously under identical conditions
Complementation linesConfirm phenotype causalityNative promoter driving wild-type At3g08680 in knockout background
Multiple independent transgenic linesRule out positional effectsAt least 3 independent lines with similar expression levels
Empty vector controlsControl for transformation processTransformation with empty vector or unrelated gene
Azygous segregantsControl for T-DNA effectsWild-type segregants from heterozygous parents
Biological and technical replicatesStatistical robustnessMinimum 3 biological replicates, each with 3 technical replicates

For experimental design, randomized complete block designs (RCBDs) are recommended to control for environmental variation, as outlined in experimental design literature . When analyzing phenotypic data, factorial ANOVA is appropriate for experiments with multiple variables, allowing detection of main effects and interactions between genotype and environmental conditions.

How can I determine whether At3g08680 possesses residual kinase activity despite being classified as "inactive"?

Despite classification as "inactive," experimental verification of catalytic capacity is essential:

  • In vitro kinase activity assessment:

    • Radiometric assay: Incubate purified At3g08680 with [γ-32P]ATP and potential substrates (myelin basic protein, histone H1)

    • Non-radiometric methods: ADP-Glo Kinase Assay or ELISA-based phospho-specific antibody detection

    • Compare with known active and inactive kinase controls

    • Test auto-phosphorylation and trans-phosphorylation activities separately

  • Mutational analysis of catalytic residues:

    • Identify non-canonical residues in key motifs (ATP-binding, catalytic loop, activation segment)

    • Generate "reactivated" mutants by restoring canonical residues

    • Test activity of wild-type vs. reactivated variants

  • Structural assessment:

    • ATP binding capacity using fluorescent ATP analogs

    • Thermal shift assays with and without ATP/metal ions

    • Circular dichroism to assess secondary structure integrity

  • Data analysis considerations:

    • Establish detection limits for kinase activity assays

    • Apply appropriate statistical tests for comparing activity levels

    • Consider potential trace activity vs. experimental background

Recent research on subgroup VIII RLCKs has shown that even catalytically inactive kinases serve important functions as scaffolds or in protein complex formation, suggesting that enzymatic activity may not be necessary for biological function .

What approaches can be used to identify At3g08680 phosphorylation sites and their regulatory kinases?

To characterize At3g08680 phosphorylation:

  • Phosphorylation site identification:

    • Mass spectrometry-based phosphoproteomics

      • Enrich phosphopeptides using TiO2 or IMAC

      • LC-MS/MS analysis with collision-induced dissociation (CID) or electron transfer dissociation (ETD)

      • Phosphosite localization probability scoring

    • Targeted mutagenesis of predicted phosphorylation sites

      • S/T/Y to A (phospho-null) or D/E (phosphomimetic) mutations

      • Functional testing of mutant variants

  • Kinase identification strategies:

    • In vitro screening with recombinant kinase libraries

    • Kinase inhibitor profiling in vivo

    • Genetic screens using kinase mutant collections

    • Proximity-based biotinylation (BioID, TurboID) to identify associated kinases

  • Functional validation of phosphorylation:

    • Phosphorylation-dependent protein interactions

    • Effects on protein stability and turnover

    • Subcellular localization changes

    • Complex formation dynamics

Studies on related RLCKs indicate that calcium-dependent protein kinases like CPK28 phosphorylate multiple residues in critical regions for kinase activation , suggesting similar kinases may regulate At3g08680.

How can I assess At3g08680's potential role in plant immune response pathways?

To investigate At3g08680's function in immunity:

  • Pathogen response phenotyping:

    • Challenge At3g08680 mutants with diverse pathogens:

      • Bacterial pathogens (Pseudomonas syringae strains)

      • Fungal pathogens (Botrytis cinerea, powdery mildew)

      • Oomycete pathogens (Hyaloperonospora arabidopsidis)

    • Quantitative disease assessment:

      • Bacterial growth curves

      • Lesion area measurements

      • Spore production quantification

  • Early immune response measurement:

    • ROS (Reactive Oxygen Species) burst assays

      • Luminol-based chemiluminescence

      • Compare wild-type vs. mutant responses to PAMPs (flg22, elf18, chitin)

      • Analyze both amplitude and kinetics of ROS production

    • MAPK activation dynamics

    • Callose deposition

    • Defense gene expression profiling

  • Genetic interaction studies:

    • Generate double/triple mutants with known immune components

    • Epistasis analysis to place At3g08680 in signaling hierarchies

    • Suppressor screens to identify genetic modifiers

Research on related RLCKs suggests they can function as negative regulators of immune-triggered oxidative burst , providing a framework for investigating At3g08680's potential role in similar processes.

What computational approaches can predict functional domains and critical residues in At3g08680?

To predict functional features of At3g08680:

  • Sequence-based predictions:

    • Domain identification:

      • SMART, Pfam, InterProScan for conserved domains

      • TMHMM for transmembrane regions

      • SignalP for signal peptides

    • Functional motif detection:

      • ELM (Eukaryotic Linear Motif) for short functional motifs

      • ScanProsite for domain-specific patterns

      • MEME for novel motif discovery

  • Structural predictions:

    • Homology modeling:

      • SWISS-MODEL, I-TASSER, or AlphaFold2

      • Template selection from related kinase structures

      • Model quality assessment with QMEAN, MolProbity

    • Molecular dynamics simulations:

      • Stability analysis of predicted structures

      • Identification of flexible regions

      • Potential ligand binding sites

  • Evolutionary analysis:

    • Sequence conservation mapping:

      • ConSurf for evolutionary conservation visualization

      • EvolutionaryTrace for functional residue prediction

      • Selection pressure analysis (dN/dS ratios)

    • Co-evolution analysis:

      • GREMLIN or EVcouplings for co-evolving residue pairs

      • Prediction of structural contacts and functional interfaces

  • Integration of computational predictions:

    • Combine multiple methods for consensus predictions

    • Prioritize residues for experimental validation

    • Map predictions onto structural models for visualization

These computational approaches provide testable hypotheses about At3g08680 function that can guide experimental design.

How can I develop quantitative models of At3g08680's role in signaling networks?

To model At3g08680's role in signaling networks:

  • Data collection for model parameterization:

    • Time-resolved quantitative measurements:

      • Protein abundance (western blot, quantitative proteomics)

      • Phosphorylation dynamics (phospho-specific antibodies, MS)

      • Protein-protein interaction kinetics (SPR, FRET)

      • Downstream response metrics (ROS, gene expression)

    • Dose-response relationships with varying stimuli

  • Model development approaches:

    • Ordinary differential equation (ODE) models:

      • Mass-action kinetics for binding interactions

      • Michaelis-Menten kinetics for enzymatic reactions

      • Parameter estimation from experimental data

    • Boolean network models:

      • Logical rules based on genetic evidence

      • Qualitative representation of regulatory relationships

      • Network attractors and steady states analysis

    • Agent-based models:

      • Spatial considerations in signaling

      • Stochastic effects at low molecule numbers

  • Model validation and refinement:

    • Experimental testing of model predictions

    • Sensitivity analysis for parameter importance

    • Cross-validation with independent datasets

    • Model selection based on information criteria

  • Data management for modeling:

    • Implementation of reproducible analysis workflows

    • Version control for model iterations

    • Consider collaborative platforms for team modeling efforts, potentially including approaches like DataSHIELD for pooled analysis while addressing privacy concerns

What factorial experimental designs are most appropriate for studying At3g08680 function under multiple stress conditions?

For multi-factor experiments investigating At3g08680:

  • Factorial design selection:

    • Completely randomized factorial design:

      • For controlled environment studies (growth chambers)

      • When all factors can be fully randomized

      • Example: 3 genotypes × 4 treatments × 3 time points

    • Randomized complete block factorial design:

      • For experiments with environmental gradients

      • Blocks control for known sources of variation

      • Example: Greenhouse experiments with bench position as blocks

  • Key considerations for robust design:

    • Sample size determination:

      • Power analysis based on preliminary data or similar studies

      • Typically minimum n=4 biological replicates per condition

      • Consider variance components from previous experiments

    • Randomization strategy:

      • Complete randomization within blocks

      • Stratified randomization if needed

      • Document randomization procedure

  • Advanced design options:

    • Split-plot designs:

      • For factors applied at different experimental units

      • When some treatments are difficult to randomize

      • Example: Temperature as whole-plot factor, watering as sub-plot factor

    • Fractional factorial designs:

      • When testing many factors is resource-intensive

      • Focus on main effects and selected interactions

      • Requires careful aliasing pattern selection

  • Analysis framework:

    • Multi-factor ANOVA with appropriate error terms

    • Mixed effects models for designs with random factors

    • Post-hoc tests with correction for multiple comparisons

The appropriate experimental design ensures statistical power to detect biologically meaningful effects while controlling for confounding variables.

How should I design time-course experiments to study At3g08680's role in early immune signaling events?

For time-course experiments:

For repeated measures designs, it's critical to test for sphericity violations and apply corrections as needed, as described in the statistical literature on time-course data analysis .

What are the optimal protein-protein interaction methods to identify At3g08680 binding partners?

A comprehensive strategy using complementary methods:

  • Discovery-phase methods:

    • Affinity purification-mass spectrometry (AP-MS):

      • Epitope-tagged At3g08680 expressed at native levels

      • Single-step or tandem affinity purification

      • SAINT or CRAPome analysis for specificity scoring

      • Typically identifies stable interactions

    • Proximity labeling:

      • BioID or TurboID fusions to At3g08680

      • Captures transient and proximal interactions

      • Complements AP-MS for comprehensive interactome

    • Yeast two-hybrid screening:

      • Suitable for direct binary interactions

      • Use both N- and C-terminal fusions as baits

      • Consider membrane yeast two-hybrid for membrane-proximal interactions

  • Validation-phase methods:

    • In planta co-immunoprecipitation:

      • Reciprocal tags on interaction partners

      • Native conditions to preserve complexes

      • Quantitative western blot analysis

    • Bimolecular fluorescence complementation (BiFC):

      • Visualizes interactions in cellular context

      • Provides subcellular localization information

      • Controls for spontaneous reporter complementation

    • FRET/FLIM analysis:

      • Quantitative interaction strength measurement

      • High spatial resolution

      • Detects dynamic interaction changes

  • Biochemical characterization:

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

      • Determination of binding kinetics (kon, koff)

      • Affinity measurements (KD)

      • Effect of phosphorylation on binding parameters

    • Isothermal titration calorimetry (ITC):

      • Label-free interaction thermodynamics

      • Stoichiometry determination

      • Enthalpy and entropy contributions

  • Data integration:

    • Confidence scoring across multiple methods

    • Network analysis of interaction data

    • Correlation with functional assays

Research on related RLCKs has successfully employed these approaches to identify interactions with calcium-dependent protein kinases and other signaling components .

What statistical approaches should be used for analyzing complex phenotypic data from At3g08680 studies?

For robust statistical analysis of phenotypic data:

  • Preliminary data exploration:

    • Descriptive statistics for each experimental group

    • Distribution assessment:

      • Shapiro-Wilk test for normality

      • Q-Q plots for visual inspection

      • Levene's test for homogeneity of variance

    • Data visualization:

      • Box plots with data points

      • Interaction plots for factorial designs

      • Residual plots for model checking

  • Statistical model selection:

    • Linear models for normally distributed data:

      • t-tests for simple comparisons

      • ANOVA for multiple group comparisons

      • Mixed-effects models for nested or repeated measures designs

    • Generalized linear models for non-normal data:

      • Poisson regression for count data

      • Logistic regression for binary outcomes

      • Gamma regression for strictly positive continuous data with variance proportional to mean

    • Non-parametric alternatives when assumptions are violated:

      • Mann-Whitney U test (instead of t-test)

      • Kruskal-Wallis test (instead of one-way ANOVA)

      • Aligned rank transform for factorial designs

  • Post-hoc analysis:

    • Multiple comparison corrections:

      • Tukey's HSD for all pairwise comparisons

      • Dunnett's test for comparisons against control

      • Bonferroni or Holm's method for selected comparisons

    • Contrast analysis for specific hypotheses

    • Effect size calculations (Cohen's d, η²)

  • Power analysis and sample size planning:

    • A priori power analysis for experiment planning

    • Post-hoc power analysis for result interpretation

    • Power analysis for interaction effects in factorial designs

How can I overcome solubility issues when expressing recombinant At3g08680 protein?

Common solubility challenges and solutions:

  • Optimization of expression conditions:

    • Temperature modulation:

      • Lower induction temperature (16-18°C)

      • Extended expression time (overnight at low temperature)

    • Induction optimization:

      • Reduced inducer concentration (0.1 mM IPTG vs. standard 1 mM)

      • Auto-induction media for gradual protein expression

    • Media supplementation:

      • Addition of compatible solutes (sorbitol, betaine)

      • Supplementation with cofactors (ATP, metal ions)

  • Construct engineering strategies:

    • Solubility-enhancing fusion partners:

      • MBP (Maltose Binding Protein): Highly effective solubilizer

      • SUMO: Enhances folding and solubility

      • Thioredoxin (Trx): Aids disulfide bond formation

    • Domain-based approaches:

      • Expression of individual domains

      • Testing different N/C-terminal boundaries

      • Removal of hydrophobic regions

  • Co-expression approaches:

    • Molecular chaperones:

      • GroEL/ES, DnaK/J, trigger factor

      • Combination chaperone sets available on commercial plasmids

    • Co-expression with binding partners:

      • Identify and co-express stable complex components

      • Express kinase with its substrates or regulators

  • Detergent and buffer optimization:

    • Mild non-ionic detergents:

      • 0.05-0.1% Triton X-100

      • 0.05-0.1% NP-40

      • 0.01-0.05% CHAPS

    • Buffer composition:

      • High salt (300-500 mM NaCl) to shield ionic interactions

      • Glycerol (5-10%) as stabilizing agent

      • Arginine/glutamate mixture for suppressing aggregation

These strategies can significantly improve the yield of soluble, functional At3g08680 protein for biochemical and structural studies.

What are the best approaches for generating specific antibodies against At3g08680?

Strategies for At3g08680 antibody development:

  • Antigen design considerations:

    • Full-length protein versus peptide approach:

      • Full-length: Complete epitope spectrum but challenging if poorly soluble

      • Peptide: Easier production but limited epitope representation

    • Peptide selection criteria:

      • 15-20 amino acids in length

      • High surface accessibility prediction

      • Low sequence conservation with related kinases

      • Avoid post-translational modification sites

      • Terminal regions often more immunogenic

  • Immunization strategies:

    • Animal selection:

      • Rabbits: Larger serum volumes, longer immunization timeline

      • Guinea pigs: Alternative for multi-antibody generation

      • Chickens: Evolutionary distance enhances immunogenicity of conserved proteins

    • Immunization protocol:

      • Multiple boost strategy (minimum 3-4 boosts)

      • Adjuvant selection (Freund's, ribi, alum)

      • Titer monitoring to determine optimal harvest time

  • Antibody purification options:

    • Affinity purification approaches:

      • Antigen-specific affinity columns

      • Protein A/G for IgG purification

      • Peptide epitope columns for highest specificity

    • Cross-adsorption against related proteins:

      • Removes antibodies recognizing conserved epitopes

      • Enhances specificity for unique epitopes

  • Validation requirements:

    • Specificity tests:

      • Western blot with positive and negative controls

      • Testing against knockout/knockdown lines

      • Pre-adsorption controls

    • Applications testing:

      • Immunoprecipitation efficiency

      • Immunofluorescence optimization

      • ELISA sensitivity and dynamic range

Generation of specific antibodies requires careful design and extensive validation, but provides valuable tools for studying native At3g08680 in various experimental contexts.

How can I design experiments to distinguish between direct and indirect effects of At3g08680 on immune signaling?

To distinguish direct from indirect effects:

  • Temporal resolution approaches:

    • Inducible expression systems:

      • Estradiol-inducible promoters

      • Dexamethasone-inducible systems

      • Temperature-sensitive degrons

    • Time-course analysis:

      • High-resolution time points after induction

      • Correlation of At3g08680 levels with response timing

      • Mathematical modeling of response kinetics

  • Biochemical interaction verification:

    • In vitro reconstitution:

      • Defined component systems with purified proteins

      • Step-wise addition experiments

      • Direct measurement of modification states

    • Proximity labeling with temporal control:

      • Rapid biotinylation of proximal proteins

      • Identification of primary vs. secondary interactions

      • Comparison across timepoints after stimulus

  • Genetic approaches:

    • Separation-of-function mutations:

      • Domain-specific mutations affecting distinct functions

      • Phosphosite mutants to block specific modifications

    • Epistasis analysis:

      • Double mutant analysis with upstream/downstream components

      • Hierarchical positioning in signaling pathways

      • Suppressor screens to identify genetic interactions

  • Data analysis for causality:

    • Conditional independence testing

    • Granger causality for time-series data

    • Structural equation modeling

    • Bayesian network inference

What methods can detect potential structural changes in At3g08680 upon binding to interaction partners?

To monitor structural changes upon binding:

  • Solution-based structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

      • Maps regions with altered solvent accessibility

      • Identifies binding interfaces and allosteric changes

      • Temporal resolution of structural dynamics

    • Small-angle X-ray scattering (SAXS):

      • Low-resolution envelope changes upon binding

      • Radius of gyration measurements

      • Conformational ensemble analysis

    • Circular dichroism (CD) spectroscopy:

      • Secondary structure composition changes

      • Thermal stability shifts upon binding

      • Fast and accessible technique for initial screening

  • Fluorescence-based approaches:

    • Intrinsic tryptophan fluorescence:

      • Changes in local environment around Trp residues

      • Simple label-free approach

      • Limited to proteins with strategically positioned Trp

    • Site-specific fluorescent labeling:

      • Introduction of environmentally sensitive fluorophores

      • FRET pairs to measure domain movements

      • Single-molecule FRET for conformational distributions

  • Crosslinking mass spectrometry:

    • Chemical crosslinking coupled with MS:

      • Maps proximities between specific residues

      • Identifies conformational changes upon binding

      • Complex data analysis but high structural detail

    • Photo-crosslinking:

      • Site-specific unnatural amino acid incorporation

      • UV-inducible crosslinking for temporal control

      • Highly specific interaction detection

  • Advanced structural biology:

    • Cryo-electron microscopy:

      • Near-atomic resolution of complexes

      • Visualization of conformational changes

      • Multiple states within single dataset

    • Nuclear magnetic resonance (NMR):

      • Residue-specific chemical shift perturbations

      • Dynamics measurements at multiple timescales

      • Limited to smaller proteins or domains

These complementary approaches provide insights into how At3g08680 structure changes upon interaction, potentially revealing mechanisms of action despite its catalytic inactivity.

What emerging technologies show promise for understanding At3g08680 function in plant immunity?

Cutting-edge approaches for future research:

  • CRISPR-based functional genomics:

    • Base editing for precise residue modifications:

      • Non-disruptive point mutations

      • Modification of specific phosphorylation sites

      • Generation of separation-of-function alleles

    • Prime editing for targeted sequence replacements

    • CRISPR activation/interference for expression modulation

    • Multiplexed CRISPR for pathway analysis

  • Single-cell technologies:

    • Single-cell RNA-seq for cell-type specific responses:

      • Resolution of heterogeneous immune responses

      • Identification of cell populations regulated by At3g08680

      • Trajectory analysis during immune activation

    • Spatial transcriptomics:

      • Tissue-level resolution of immune responses

      • Spatial coordination of signaling

      • Integration with cell-type markers

  • Advanced protein modification analysis:

    • Targeted proteomics for signaling networks:

      • Parallel reaction monitoring (PRM) for specific phosphosites

      • Absolute quantification of pathway components

      • Integration of multiple PTM types (phosphorylation, ubiquitination)

    • Proximity proteomics with subcellular resolution:

      • Organelle-specific interactome mapping

      • Temporal dynamics of interaction networks

      • Ratiometric APEX labeling for comparative studies

  • Systems biology integration:

    • Multi-omics data integration:

      • Correlation of transcript, protein, and metabolite changes

      • Network inference from integrated datasets

      • Causal modeling with temporal data

    • Machine learning approaches:

      • Pattern recognition in complex phenotypic data

      • Prediction of regulatory relationships

      • Feature importance ranking for mechanism discovery

These emerging technologies will provide unprecedented insights into At3g08680 function within the complex landscape of plant immune signaling.

How might understanding At3g08680 function contribute to improving crop resistance to pathogens?

Translational implications for agriculture:

  • Knowledge transfer to crop species:

    • Identification of orthologs in major crops:

      • Sequence-based ortholog prediction

      • Functional conservation testing

      • Expression pattern comparison

    • Comparative analysis across plant families:

      • Conservation of regulatory mechanisms

      • Divergence in pathogen response specificity

      • Correlation with host range differences

  • Engineering strategies based on At3g08680 insights:

    • Precision breeding approaches:

      • TILLING populations for ortholog variants

      • Marker-assisted selection for beneficial alleles

      • Haplotype analysis for superior variants

    • Transgenic approaches:

      • Modified expression levels

      • Engineering of interaction interfaces

      • Synthetic scaffold proteins based on inactive kinase architecture

  • Broad-spectrum resistance strategies:

    • Targeting conserved immune regulatory nodes:

      • Engineering of sustained immune activation

      • Prevention of pathogen-mediated suppression

      • Fine-tuning of defense-growth tradeoffs

    • Combination with other resistance mechanisms:

      • R-gene mediated resistance

      • Pattern-triggered immunity components

      • PAMP receptor engineering

  • Validation in crop systems:

    • Controlled environment testing:

      • Disease challenge assays

      • Fitness cost assessment

      • Abiotic stress tolerance

    • Field trial design:

      • Multiple environments and seasons

      • Natural disease pressure monitoring

      • Yield component analysis

Understanding the basic mechanisms of At3g08680 function in Arabidopsis provides a foundation for translational approaches in crops, potentially contributing to sustainable disease resistance strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.