Recombinant Arabidopsis thaliana Probable inactive receptor kinase At4g23740 (At4g23740)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Probable inactive receptor kinase At4g23740 (At4g23740) is a protein kinase that is produced utilizing an in vitro E. coli expression system. It is also known by the synonyms At4g23740 and F9D16.210. The corresponding gene locus is AT4G23740 in Arabidopsis thaliana .

  • Catalog Number: BT2482238

  • Source: in vitro E.coli expression system

  • Species: Arabidopsis thaliana (Mouse-ear cress)

  • UniProt ID: Q9SUQ3

  • Protein Length: Full Length of Mature Protein

  • Expression Region: 25-638

  • Molecular Weight: Information not available in the provided documents.

  • Domains: Protein kinase superfamily

  • Subcellular location: Membrane; Single-pass membrane protein

Expression and Purification

At4g23740 is expressed in an in vitro E. coli system and supplied as a lyophilized powder. Key points regarding its preparation include:

  • The protein is produced in vitro using an E. coli expression system.

  • It is shipped with ice packs to maintain stability during transit. Dry ice shipping is available upon request with additional charges.

  • Reconstitution should be performed by centrifuging the vial briefly and reconstituting the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding 5-50% glycerol and aliquoting at -20°C/-80°C is recommended.

Biological Function and Significance

While At4g23740 is annotated as a "probable inactive receptor kinase," receptor-like kinases (RLKs) play diverse roles in plant biology .

  • ** defense signaling:** Some RLKs are involved in plant immunity and defense signaling . For example, LecRK-I.8, a lectin receptor kinase, can bind NAD+ and is required for basal resistance against bacterial pathogens .

  • ** meristem size control:** The CLAVATA1 gene encodes a receptor kinase that controls shoot and floral meristem size in Arabidopsis .

  • ** stress response:** PSKR2, another receptor, modulates seed development, fertilization, osmotic stress, and bacterial infection response .

  • ** pollen tube reception:** FERONIA, is involved in pollen tube reception in Arabidopsis .

Database Links

At4g23740 has several links in biological databases that provide additional information:

  • KEGG: ath:AT4G23740

  • STRING: 3702.AT4G23740.1

  • UniGene: At.27883

  • UniProt: Q9SUQ3

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At4g23740; F9D16.210; Probable inactive receptor kinase At4g23740
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-638
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g23740
Target Protein Sequence
DPLEDKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRLPGVGLNGQI PPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLT SVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSGDIPDLSVLSSLQHIDLSNNYDLAGP IPDWLRRFPFSSYTGIDIIPPGGNYTLVTPPPPSEQTHQKPSKARFLGLSETVFLLIVIA VSIVVITALAFVLTVCYVRRKLRRGDGVISDNKLQKKGGMSPEKFVSRMEDVNNRLSFFE GCNYSFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGKRDFEQQMEII GGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGA AKGIARIHKENNGKLVHGNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAP EVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFD IELLRYTNIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPEPELKPK SENGASETSTPSEI
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G23740

STRING: 3702.AT4G23740.1

UniGene: At.27883

Protein Families
Protein kinase superfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular classification of At4g23740?

At4g23740 is classified as a leucine-rich repeat protein kinase family protein in Arabidopsis thaliana. The protein contains characteristic leucine-rich repeat domains involved in protein-protein interactions and a kinase domain that is predicted to be inactive based on sequence analysis. This classification places At4g23740 within the broader context of plant receptor-like kinases, which play crucial roles in signal transduction during plant development and immune responses .

How does the recombinant form of At4g23740 differ from the native protein?

The recombinant form of At4g23740 available for research applications is produced in E. coli and contains several modifications from the native protein:

FeatureNative At4g23740Recombinant At4g23740
Expression systemArabidopsis thalianaEscherichia coli
Protein lengthFull protein (aa 1-638)Mature protein (aa 25-638)
TagsNoneN-terminal His tag
GlycosylationPresent (plant-specific)Absent
FormMembrane-associatedLyophilized powder
FoldingNative conformationMay have differences due to prokaryotic expression

These differences must be considered when designing experiments using the recombinant protein, as they may affect protein folding, activity, and interaction capabilities .

What are the optimal storage and handling conditions for the recombinant At4g23740 protein?

The recombinant At4g23740 protein requires specific storage and handling conditions to maintain its stability and activity. The protein is supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For longer-term storage, it is essential to aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality and activity.

For reconstitution, the protein should be:

  • Briefly centrifuged before opening to bring contents to the bottom

  • Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Supplemented with glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquoted and stored at -20°C/-80°C

Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided. The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage .

What experimental approaches are recommended for studying the phosphorylation activity of At4g23740?

Although At4g23740 is predicted to be an inactive receptor kinase, experimental validation of this prediction requires rigorous biochemical approaches. The following methodological workflow is recommended for investigating its kinase activity:

  • In vitro kinase assays: Using the purified recombinant At4g23740 protein with potential substrates and radiolabeled ATP (γ-32P-ATP) or ATP analogs to detect phosphorylation events.

  • Phosphorylation site mapping: If phosphorylation activity is detected, mass spectrometry analysis should be conducted to identify specific phosphorylation sites.

  • Mutational analysis: Creating point mutations in key residues of the predicted kinase domain to validate their importance for activity.

  • Comparative analysis: Comparing the kinase domain of At4g23740 with well-characterized active kinases like RIPK (At2g05940) to identify potential structural differences that might explain inactivity.

  • Physiological validation: Using phospho-specific antibodies to detect substrate phosphorylation in planta following various stimuli.

These approaches should be conducted under various conditions (different pH, temperatures, cofactors) to thoroughly evaluate the kinase activity of At4g23740 .

How can researchers effectively use experimental and quasi-experimental designs to study At4g23740 function in planta?

To rigorously study the function of At4g23740 in planta, researchers should consider the following experimental design approaches:

  • Randomized Controlled Trials (RCTs): Generate At4g23740 knockout, knockdown, and overexpression lines in Arabidopsis thaliana to study phenotypic changes under controlled conditions. This approach allows for direct comparison between experimental and control groups with randomization to minimize bias.

  • Interrupted Time Series (ITS) design: Monitor phenotypic changes or expression patterns of related genes before and after inducing At4g23740 expression using inducible promoters. This approach is particularly useful for studying the temporal dynamics of At4g23740 function.

  • Stepped Wedge Design: Implement a staggered introduction of At4g23740 expression across different tissues or developmental stages, allowing each subject to serve as its own control while also controlling for time-dependent confounding variables.

  • SMART (Sequential Multiple Assignment Randomized Trial) design: Implement sequential treatments or experimental conditions based on plant responses to initial manipulations of At4g23740, allowing for adaptive experimental protocols.

Each of these designs has specific strengths for addressing different aspects of At4g23740 function, from immediate signaling responses to long-term developmental impacts. The selection of an appropriate design should be guided by the specific research question and the available resources .

How does At4g23740 potentially function in plant immunity compared to well-characterized receptor-like kinases?

While specific functional data for At4g23740 is limited, we can draw parallels with better-characterized receptor-like kinases in Arabidopsis, such as RIPK (RPM1 induced protein kinase). Based on structural similarities and evolutionary relationships, At4g23740 may function in plant immunity through the following mechanisms:

  • Pathogen recognition: The leucine-rich repeat domains in At4g23740 likely function in recognizing pathogen-associated molecular patterns (PAMPs) or damage-associated molecular patterns (DAMPs).

  • Signal transduction: Despite being predicted as "inactive," At4g23740 may function as a pseudokinase that interacts with active kinases to modulate immune responses, similar to how some receptor-like proteins function without kinase activity.

  • Protein complex formation: At4g23740 may form complexes with other immune receptors or signaling components, potentially serving as a scaffold or regulatory protein rather than an active kinase.

  • Effector targets: Similar to RIN4, which is targeted by multiple Pseudomonas syringae effectors, At4g23740 might serve as a target for pathogen effectors, with modifications to At4g23740 triggering downstream immune responses.

Experimental evidence from studies of related receptor-like kinases suggests that these proteins often function in multiprotein complexes and can have roles beyond their predicted enzymatic activities .

What approaches can be used to identify potential interaction partners of At4g23740?

Identifying protein interaction partners is crucial for understanding the function of At4g23740 in cellular signaling networks. The following methodological approaches are recommended:

  • Yeast two-hybrid screening: Using the cytoplasmic domain of At4g23740 as bait to screen an Arabidopsis cDNA library for potential interactors.

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry: Expressing tagged versions of At4g23740 in Arabidopsis and isolating protein complexes for identification of components.

  • Bimolecular Fluorescence Complementation (BiFC): Validating specific protein-protein interactions in planta by observing the reconstitution of fluorescence when potential interacting partners are brought together.

  • Proximity-dependent biotin identification (BioID): Fusing At4g23740 to a biotin ligase to biotinylate proximal proteins, which can then be purified and identified by mass spectrometry.

  • Split-ubiquitin membrane yeast two-hybrid: Specifically designed for membrane proteins like At4g23740, this technique can identify interactions that occur at or near the plasma membrane.

  • Protein microarrays: Using purified recombinant At4g23740 protein to probe Arabidopsis protein arrays for potential binding partners.

A sequential approach combining these methods is recommended, starting with high-throughput screening methods followed by validation using more targeted approaches .

How can phosphoproteomic approaches be used to elucidate the potential substrates of At4g23740?

Despite being classified as a probable inactive receptor kinase, it remains important to investigate potential phosphorylation activity of At4g23740 using comprehensive phosphoproteomic approaches:

  • Global phosphoproteomic analysis: Compare phosphopeptide profiles between wild-type plants and At4g23740 overexpression or knockout lines to identify differentially phosphorylated proteins.

  • Targeted phosphopeptide enrichment: Use titanium dioxide (TiO₂) or immobilized metal affinity chromatography (IMAC) to enrich phosphopeptides before mass spectrometric analysis.

  • Quantitative phosphoproteomics: Implement stable isotope labeling approaches (e.g., SILAC, iTRAQ, TMT) to quantitatively compare phosphorylation levels between experimental conditions.

  • Kinase-substrate relationships: Use consensus phosphorylation site motifs derived from characterized kinases to predict potential At4g23740 substrates.

  • In vitro kinase assays with proteome arrays: Use recombinant At4g23740 protein in kinase assays with protein microarrays to identify potential substrates.

  • Validation with phospho-specific antibodies: Develop antibodies against predicted phosphorylation sites to validate specific substrate modifications in vivo.

These approaches should be applied under various conditions, including different developmental stages and stress treatments, to comprehensively map the potential role of At4g23740 in phosphorylation networks .

What genetic approaches can resolve functional redundancy between At4g23740 and related receptor-like kinases?

Functional redundancy is a common challenge when studying large protein families like receptor-like kinases in Arabidopsis. To address potential redundancy involving At4g23740, researchers should consider the following genetic approaches:

  • Higher-order mutant analysis: Generate double, triple, or higher-order mutants combining knockouts of At4g23740 with closely related receptor-like kinases identified through phylogenetic analysis.

  • Tissue-specific or inducible silencing: Use artificial microRNAs or RNA interference constructs targeting conserved regions across multiple family members, with tissue-specific or inducible promoters to avoid developmental lethality.

  • CRISPR/Cas9 multiplexing: Target multiple related genes simultaneously using multiplexed CRISPR/Cas9 gene editing to create combinatorial mutants.

  • Dominant negative approaches: Express modified versions of At4g23740 designed to interfere with the function of related proteins through competition for binding partners or substrates.

  • Synthetic genetic array analysis: Systematically cross At4g23740 mutants with mutants of other candidate genes to identify genetic interactions through enhancement or suppression of phenotypes.

These approaches can help discriminate between unique and redundant functions of At4g23740, providing insights into its specific roles within the broader context of receptor-like kinase signaling networks.

How can contradictory experimental data regarding At4g23740 function be reconciled in research publications?

Conflicting experimental results are common in complex biological systems. When encountering contradictory data regarding At4g23740 function, researchers should apply the following analytical and methodological approaches:

  • Experimental condition assessment: Carefully analyze differences in experimental conditions, including plant growth conditions, developmental stages, stress treatments, and genetic backgrounds, which may explain apparently contradictory results.

  • Methodological comparison: Evaluate the sensitivity, specificity, and limitations of different methodological approaches used across studies, recognizing that different techniques may access different aspects of protein function.

  • Quantitative re-analysis: When possible, perform meta-analyses or re-analyze raw data from contradictory studies using standardized statistical methods.

  • Contextual interpretation: Consider that At4g23740 may have context-dependent functions that vary across tissues, developmental stages, or environmental conditions.

  • Validation through orthogonal approaches: Design experiments that test the same hypothesis using multiple independent methodologies to provide more robust evidence.

  • Rigorous controls: Implement positive and negative controls that can help distinguish between true biological effects and experimental artifacts.

By systematically addressing these aspects, researchers can develop more nuanced models of At4g23740 function that accommodate apparently contradictory data within a coherent theoretical framework .

What are the implications of At4g23740's predicted inactive kinase status for evolutionary studies of receptor-like kinases?

The classification of At4g23740 as a probable inactive receptor kinase presents interesting evolutionary questions that warrant further investigation:

  • Pseudokinase evolution: Comparative genomic analyses across plant species can reveal whether At4g23740 evolved from an active kinase ancestor and when the inactivating mutations occurred.

  • Functional adaptation: Studies investigating whether the putative loss of kinase activity correlates with the gain of new functions, such as serving as a scaffold or decoy protein.

  • Selection pressure analysis: Examining the ratio of synonymous to non-synonymous substitutions in the kinase domain across species can provide evidence for altered selection pressure consistent with neofunctionalization.

  • Structural comparison: Detailed structural analysis of At4g23740's kinase domain compared to active kinases might reveal how structural modifications relate to functional changes.

  • Expression pattern evolution: Investigating whether changes in expression patterns correlate with the predicted loss of kinase activity, potentially indicating functional specialization.

These evolutionary studies can provide valuable insights into the diversification of receptor-like kinases and the specific roles of putative pseudokinases like At4g23740 in plant signaling networks .

How can systems biology approaches integrate At4g23740 into broader signaling networks?

Understanding At4g23740's role within the broader context of plant signaling requires integrative systems biology approaches:

  • Network reconstruction: Integrate protein-protein interaction data, co-expression analyses, and genetic interaction studies to position At4g23740 within larger signaling networks.

  • Multi-omics integration: Combine transcriptomic, proteomic, metabolomic, and phenomic data from At4g23740 mutants to comprehensively map its impact on cellular physiology.

  • Mathematical modeling: Develop dynamic models of signaling pathways involving At4g23740 to predict system behaviors under various conditions and in response to perturbations.

  • Comparative systems analysis: Apply network comparison approaches across species to identify conserved modules involving At4g23740 orthologs, potentially indicating fundamental signaling functions.

  • Machine learning approaches: Use supervised learning algorithms trained on known signaling pathways to predict the functional role of At4g23740 based on its network properties and expression patterns.

Systems biology approaches can reveal emergent properties not evident from reductionist studies and help prioritize hypotheses for experimental validation, accelerating our understanding of At4g23740's biological significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.