Recombinant Arabidopsis thaliana Probable inactive receptor kinase RLK902 (RLK902)

Shipped with Ice Packs
In Stock

Description

Introduction

Receptor-like kinases (RLKs) are crucial in plant signaling, facilitating the recognition of external signals and the activation of downstream immune responses . Among these, Arabidopsis thaliana RECEPTOR-LIKE KINASE 902 (RLK902) has garnered attention for its role in plant immunity and development . RLK902, a receptor-like kinase, is found on the cell surface of various tissues in Arabidopsis thaliana . Despite being identified as a receptor-like kinase, its precise function has remained largely unknown . Recent studies have begun to elucidate its involvement in plant defense mechanisms and interactions with other proteins .

Tissue Localization and Expression Patterns

RLK902 exhibits distinct tissue-specific expression patterns. In transgenic lines expressing pro::GUS, strong GUS activity was observed in root tips, lateral root primordia, stipules, and floral organ abscission zones . This suggests that RLK902 may play a role in root development, lateral root formation, and flower development .

Role in Plant Immunity

RLK902 plays a significant role in plant immunity, particularly against bacterial pathogens. It has been shown to be involved in resistance to the bacterial pathogen Pseudomonas syringae, but not to the fungal powdery mildew pathogen Golovinomyces cichoracearum . RLK902 interacts with ENHANCED DISEASE RESISTANCE 4 (EDR4), a protein involved in clathrin-mediated trafficking pathways, which regulates the subcellular trafficking and accumulation of RLK902 protein . Furthermore, RLK902 directly associates with BRASSINOSTEROID-SIGNALING KINASE1 (BSK1), a key component of plant immunity, and phosphorylates BSK1 at Ser-230, which is critical for RLK902-mediated defense signaling .

Interaction with Other Proteins

RLK902 interacts with several proteins to mediate its functions. These include:

  • EDR4: EDR4 regulates plant immunity by modulating the subcellular trafficking and protein accumulation of RLK902 .

  • BSK1: RLK902 phosphorylates BSK1, a key component of plant immunity, to transmit immune signals .

  • RLK1: RLK902 shares high sequence homology with RLK1, suggesting potential functional interactions .

Mutant Phenotypes

Studies involving mutant lines of RLK902 have provided insights into its function. Single and double knockout mutant lines of RLK902 and RKL1 did not show any significant phenotypes under normal growth conditions, suggesting the existence of complementary signaling pathways .

Involvement in Signaling Pathways

RLK902 participates in various signaling pathways, influencing plant growth, development, and defense responses. While the exact pathways are still being elucidated, RLK902's interactions and functions suggest its involvement in pathways related to immunity and stress response .

Genome Editing and Disease Resistance

Genome editing of RLK902 has demonstrated its potential in improving plant resistance to necrotrophic fungal pathogens. In Brassica napus, editing RLK902 conferred resistance to Sclerotinia sclerotiorum and Gemini virus without compromising growth and development .

Tables of Data

GeneDescriptionSpecies
RLK902Receptor-like kinase involved in plant immunity and developmentArabidopsis thaliana
RKL1Highly homologous to RLK902, may have overlapping functionsArabidopsis thaliana
EDR4Involved in clathrin-mediated trafficking, regulates RLK902 accumulationArabidopsis thaliana
BSK1Key component of plant immunity, phosphorylated by RLK902Arabidopsis thaliana
AssayResult
Resistance to Pseudomonas syringaeRLK902 confers resistance
Resistance to Golovinomyces cichoracearumNo significant resistance conferred
GUS activity in transgenic linesStrong activity in root tips, lateral root primordia, stipules, and floral organ abscission zones
Mutant phenotypes under normal conditionsNo significant phenotypes observed in single or double knockout mutants, suggesting functional redundancy or subtle roles

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
RLK902; At3g17840; MEB5.6; Probable inactive receptor kinase RLK902; Receptor-like kinase 902
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-647
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RLK902
Target Protein Sequence
DLAADKSALLSFRSAVGGRTLLWDVKQTSPCNWTGVLCDGGRVTALRLPGETLSGHIPEG IFGNLTQLRTLSLRLNGLTGSLPLDLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLN LAENEFSGEISSGFKNLTRLKTLYLENNKLSGSLLDLDLSLDQFNVSNNLLNGSIPKSLQ KFDSDSFVGTSLCGKPLVVCSNEGTVPSQPISVGNIPGTVEGSEEKKKRKKLSGGAIAGI VIGCVVGLSLIVMILMVLFRKKGNERTRAIDLATIKHHEVEIPGEKAAVEAPENRSYVNE YSPSAVKAVEVNSSGMKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTL VAVKRLKDVTMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALL HGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDF GLAQLVSASSTTPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEE GMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMV EVVRRIQELRQSGADRVG
Uniprot No.

Target Background

Gene References Into Functions
  1. A mutant line, rlk902, exhibited reduced root growth and increased downy mildew resistance in a recessive manner (PMID: 21532992).
  2. Findings suggest that RLK902 and RKL1 share common biochemical functions, particularly in signal transduction, and are involved in responses to various stress conditions, including mechanical wounding, salicylic acid treatment, and pathogen infection (PMID: 15618630).
Database Links

KEGG: ath:AT3G17840

STRING: 3702.AT3G17840.1

UniGene: At.38651

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in root tips, lateral root primordia, stipules, and floral organ abscission zones.

Q&A

What is RLK902 and what are its key structural features?

RLK902 is a leucine-rich repeat receptor-like kinase (LRR-RLK) that belongs to the LRR III subfamily in Arabidopsis thaliana. Its structure includes:

  • An extracellular domain containing leucine-rich repeats

  • A transmembrane region

  • A cytoplasmic kinase domain

RLK902 shares 75% amino acid sequence identity with its closest family member, RKL1, with the kinase domain being the most conserved region (82% identity) . The protein localizes to the plasma membrane, which is critical for its function in signal perception and transduction . The typical domains present in RLK902 are characteristic of the broader RLK family that functions in pathogen recognition and signal transduction.

What expression patterns does RLK902 show in different tissues?

RLK902 expression shows tissue-specific patterns that correlate with its function:

TissueExpression LevelDetection MethodSource
Root tipsHighGUS reporter assay
Lateral root primordiaHighGUS reporter assay
StipulesHighGUS reporter assay
Floral organ abscission zonesHighGUS reporter assay
Leaf (upon pathogen infection)InducedqPCR

In Brassica napus, BnaA05.RLK902 (ortholog) is expressed in most tissues with highest expression in buds. Upon inoculation with pathogens like S. sclerotiorum or B. cinerea, BnaA05.RLK902 shows differential expression patterns between resistant and susceptible cultivars, being strongly induced in susceptible lines but down-regulated in resistant lines .

How does RLK902 function differ between Arabidopsis and other plant species?

RLK902 shows interesting functional differentiation across plant species:

In Arabidopsis:

  • Only RLK902, not its homolog RKL1, functions significantly in immune responses to bacterial pathogens

  • Not involved in resistance to powdery mildew pathogen Golovinomyces cichoracearum

  • Functions in a complex with EDR4 and BSK1 for immune signaling

In Rice:

  • Two homologs (OsRLK902-1 and OsRLK902-2) both function in blast resistance

  • Both genes work together in the same signaling pathway

  • Involved in fungal pathogen resistance (Magnaporthe oryzae)

In Brassica napus:

  • BnaA05.RLK902 negatively regulates resistance to necrotrophic pathogens

  • Natural variations in this gene confer different levels of disease resistance

This cross-species comparison reveals evolutionary divergence in RLK902 function, particularly in pathogen specificity and resistance regulation mechanisms.

How does RLK902 regulate both growth and immunity in plants?

RLK902 exhibits an interesting dual function in regulating both plant development and immunity through distinct molecular mechanisms:

Immunity Regulation:

  • In Arabidopsis, RLK902 forms an immune complex that perceives pathogen signals and transduces them by phosphorylating BSK1 at Ser230

  • In rice, OsRLK902-1 and OsRLK902-2 function together by interacting with OsRLCK185 to regulate blast resistance

  • In Brassica napus, BnaA05.RLK902 negatively regulates JA-mediated immunity, with knockout plants showing enhanced resistance to necrotrophic pathogens

Growth Regulation:

  • RLK902 expression in root tips and lateral root primordia suggests involvement in root development

  • The rlk902 T-DNA insertion mutant showed reduced root growth and meristem size

  • In Brassica napus, BnaA05.RLK902 knockout plants maintained normal growth and development without yield penalties despite enhanced disease resistance

The antagonistic effects between growth and immunity appear to be balanced differently across species, with B. napus showing a unique ability to uncouple these pathways when BnaA05.RLK902 is inactivated.

What are the known protein interaction partners of RLK902 and how do they contribute to signal transduction?

RLK902 forms complexes with several proteins to facilitate signal transduction:

Interaction PartnerDetection MethodFunctionSpeciesCitation
BSK1Yeast two-hybrid, Co-IPPhosphorylation target at Ser230; critical for immunityArabidopsis
EDR4Co-IPRegulates subcellular trafficking and protein accumulationArabidopsis
CHC2 (Clathrin Heavy Chain 2)Indirect associationInvolved in endocytosis and subcellular traffickingArabidopsis
Y-1, Y-2, Y-3 clonesYeast two-hybridCommon interactors with RKL1 kinase domainArabidopsis
OsRLK902-2Co-IPForms heterodimeric complex; mutual stabilizationRice
OsRLCK185Co-IPStabilized by OsRLK902s; mediates chitin-triggered immunityRice

The interaction with EDR4 and CHC2 suggests that proper subcellular trafficking of RLK902 is essential for immune signaling. The phosphorylation of BSK1 represents a direct mechanism of signal transduction. In rice, the heterodimeric complex between OsRLK902-1 and OsRLK902-2 appears to be required for full functionality in immunity .

What is the role of RLK902 in JA-mediated defense responses?

RLK902 plays a critical regulatory role in jasmonic acid (JA)-mediated defense responses, particularly against necrotrophic pathogens:

Evidence for RLK902's role in JA-mediated immunity:

  • Transcriptome analysis of Arabidopsis rlk902 mutants showed significant enrichment of genes involved in "response to jasmonic acid" and "defense response to fungus"

  • Genes involved in JA biosynthesis, modification, signaling, and downstream defense responses (including lignin, camalexin, and ROS biosynthesis) were coordinately upregulated in rlk902 mutants

  • The enhanced resistance of rlk902 to necrotrophic pathogens was abolished in the rlk902 jar1-1 double mutant, where JA-Ile biosynthesis is impaired

These findings demonstrate that RLK902 functions as a negative regulator of JA-mediated immunity, and the absence of RLK902 results in constitutive activation of JA signaling pathways. This mechanism explains why knocking out BnaA05.RLK902 in Brassica napus enhances resistance to necrotrophic pathogens like Sclerotinia sclerotiorum and Botrytis cinerea .

How do genetic variations in RLK902 impact plant disease resistance?

Natural and engineered genetic variations in RLK902 significantly impact plant disease resistance:

Natural variations:

  • GWAS analysis in Brassica napus identified two significant SNPs (SNP_17,088,971 and SNP_17,088,560) in BnaA05.RLK902's third exon, defining two haplotypes

  • Haplotype 2 (AG), causing amino acid changes A344T and D570E, displayed reduced lesion sizes from Sclerotinia and Botrytis infection compared to Haplotype 1 (GC)

  • Expression analysis showed differential pathogen-induced expression patterns between resistant and susceptible lines

Engineered mutations:

  • Complete knockout of RLK902 in Arabidopsis (rlk902 mutant) increased resistance to necrotrophic pathogens

  • CRISPR/Cas9-mediated knockout of BnaA05.RLK902 in B. napus significantly enhanced resistance to Sclerotinia and Botrytis without growth penalties

  • In rice, CRISPR/Cas9-generated osrlk902-1 and osrlk902-2 knockout mutants showed enhanced susceptibility to M. oryzae

This evidence indicates that RLK902's role in disease resistance is both pathogen-specific and species-specific, with the gene acting as a negative regulator in Arabidopsis and B. napus against necrotrophic pathogens, but as a positive regulator in rice against blast fungus.

What pathogen-specific responses does RLK902 mediate?

RLK902 mediates distinct responses to different classes of pathogens:

PathogenPathogen TypePlant SpeciesRLK902 FunctionResponseCitation
Sclerotinia sclerotiorumNecrotrophic fungusB. napus, ArabidopsisNegative regulatorEnhanced resistance in knockout
Botrytis cinereaNecrotrophic fungusB. napus, ArabidopsisNegative regulatorEnhanced resistance in knockout
Pseudomonas syringaeHemi-biotrophic bacteriaArabidopsisPositive regulatorReduced resistance in knockout
Golovinomyces cichoracearumBiotrophic fungusArabidopsisNot involvedNo change in resistance
Magnaporthe oryzaeHemi-biotrophic fungusRicePositive regulatorReduced resistance in knockout
Hyaloperonospora arabidopsidisBiotrophic oomyceteArabidopsisComplex involvement*Enhanced resistance in T-DNA tagged line

*The enhanced resistance to H. arabidopsidis in the T-DNA tagged rlk902 line was found to be linked to trans-repression of genes upstream of RLK902, rather than the disruption of RLK902 itself .

This pattern reveals RLK902's complex role in the antagonistic regulation between JA-dependent and SA-dependent defense pathways, with pathogen lifestyle (biotrophic vs. necrotrophic) being a key determinant of RLK902's regulatory function.

How does the homology between RLK902 and RKL1 affect their functional redundancy?

Despite their high sequence similarity, RLK902 and RKL1 show partial functional redundancy with interesting distinctions:

Structural similarities:

  • 75% amino acid sequence identity over the entire protein

  • 82% identity in the kinase domain, which is the most conserved region

  • Both belong to the LRR III subfamily of plant RLKs

Functional comparison:

  • Single mutants rlk902 or rkl1 showed no significant phenotypes under normal growth conditions, suggesting redundancy

  • Only RLK902, not RKL1, is involved in resistance to Pseudomonas syringae, indicating divergent functions in immunity

  • Double mutant rlk902 rkl1-1 shows slightly enhanced reduction in root length compared to rlk902 single mutant, suggesting partial redundancy in root development

  • Both proteins interact with the same three clones (Y-1, Y-2, Y-3) in yeast two-hybrid screens, indicating shared downstream signaling components

  • Different expression patterns: RLK902 expressed in root tips and lateral root primordia, while RKL1 dominantly expressed in stomata cells and trichomes of young leaves

The evidence suggests that while RLK902 and RKL1 share significant sequence similarity and some downstream signaling components, they have evolved partially divergent functions, particularly in pathogen defense, which may be attributed to their different expression patterns and potential interaction with different upstream components.

What are the most effective methods for studying RLK902 function in different plant species?

MethodologyApplicationAdvantagesLimitationsExamples from Literature
CRISPR/Cas9 Gene EditingCreating knockout mutants- Precise targeting
- Can target multiple homologs
- Applicable across species
- Requires efficient transformation systems
- Off-target effects possible
- Generation of osrlk902-1 and osrlk902-2 in rice
- BnaA05.rlk902 knockout in B. napus
T-DNA Insertion LinesDisruption of gene function- Readily available collections
- Stable inheritance
- Random insertion
- Potential for complex phenotypes due to trans-effects
- Limited to model species
- Arabidopsis rlk902 and rkl1 mutants
Complementation AnalysisValidation of gene function- Confirms causality
- Can test specific domains/variants
- Requires transformation
- Expression levels may differ from native
- Expression of BnaA05.RLK902 haplotypes in Arabidopsis rlk902
Protein-Protein InteractionIdentify signaling complexes- Reveals mechanism
- Maps signaling networks
- May detect interactions not occurring in vivo- Y2H screening of RLK902 interactors
- Co-IP of OsRLK902-1 and OsRLK902-2
TranscriptomicsPathway and network analysis- Unbiased whole-genome approach
- Identifies downstream targets
- Secondary effects difficult to distinguish
- Tissue-specific changes may be masked
- RNA-seq of rlk902 mutant before/after pathogen infection
Pathogen AssaysEvaluating disease resistance- Direct functional assessment
- Quantifiable phenotypes
- Environmental variables affect results
- Different pathogens require different methods
- Detached leaf assays for necrotrophic pathogens
- Spray inoculation for M. oryzae

For comprehensive functional characterization, researchers should employ multiple complementary approaches. For example, the combination of CRISPR-generated knockout lines with protein interaction studies and transcriptomics has proven particularly informative in recent RLK902 research .

How can researchers effectively study the phosphorylation targets and activity of RLK902?

Studying RLK902's kinase activity and phosphorylation targets requires specialized techniques:

In vitro kinase assays:

  • Purify recombinant RLK902 kinase domain (amino acids 688-1014 for Arabidopsis RLK902)

  • Incubate with potential substrates (e.g., BSK1) in kinase buffer containing ATP

  • Detect phosphorylation by:

    • Radioactive labeling using [γ-32P]ATP

    • Phospho-specific antibodies

    • Mass spectrometry to identify specific phosphorylated residues

Phosphosite mapping:

  • Perform in vitro kinase assays with recombinant RLK902 and substrate

  • Digest phosphorylated proteins with trypsin

  • Enrich phosphopeptides using TiO2 or IMAC

  • Analyze by LC-MS/MS to identify specific phosphorylation sites

  • Validate functional importance by mutating identified sites (e.g., S230A mutation in BSK1)

In vivo phosphorylation analysis:

  • Generate transgenic plants expressing tagged versions of potential targets

  • Immunoprecipitate proteins before and after pathogen treatment

  • Analyze phosphorylation status by:

    • Phospho-specific antibodies

    • Phos-tag SDS-PAGE to detect mobility shifts

    • Mass spectrometry of immunoprecipitated proteins

These approaches were successfully applied to identify BSK1's Ser230 as a key phosphorylation site by RLK902, which was critical for RLK902-mediated defense signaling .

What are the optimal experimental designs for investigating RLK902's role in pathogen resistance?

Designing robust experiments to evaluate RLK902's role in pathogen resistance requires considering multiple factors:

Genetic materials preparation:

  • Generate knockout mutants using CRISPR/Cas9 or identify T-DNA insertion lines

  • Create complementation lines expressing RLK902 variants

  • Develop double mutants with genes in related pathways (e.g., rlk902 jar1-1)

  • Include appropriate wild-type controls and resistant/susceptible references

Pathogen inoculation methods:

  • For necrotrophic fungi (S. sclerotiorum, B. cinerea):

    • Detached leaf assay: Place agar plugs with mycelia on detached leaves

    • Measure lesion diameter at 24-48 hours post-inoculation

  • For bacterial pathogens (P. syringae):

    • Syringe infiltration at defined bacterial concentrations (e.g., 1×105 CFU/ml)

    • Measure bacterial growth at 0 and 3 days post-inoculation

  • For rice blast (M. oryzae):

    • Spray inoculation of spore suspension (1×105 conidia/ml)

    • Score disease symptoms after 7 days

Phenotypic evaluation:

  • Macroscopic assessment: Lesion size, bacterial titer, disease index

  • Microscopic evaluation: Pathogen structures, cell death, callose deposition

  • Biochemical markers: ROS accumulation (DAB staining), defense gene expression

Time course considerations:

  • Early responses: ROS burst (minutes to hours), MAP kinase activation

  • Intermediate responses: Defense gene induction (hours)

  • Late responses: Visible symptoms, pathogen proliferation (days)

Including hormone signaling inhibitors or exogenous hormone applications can further elucidate the pathways involved. For example, comparing the response in wild-type, rlk902, and rlk902 jar1-1 plants revealed the critical role of JA signaling in RLK902-mediated resistance .

How should researchers interpret conflicting data about RLK902 function across different plant species?

When faced with seemingly contradictory findings about RLK902 function across plant species, researchers should consider:

Evolutionary divergence:

  • RLK902 orthologs may have evolved different functions in different plant lineages

  • Compare protein sequence conservation, especially in key functional domains

  • Analyze synteny to confirm true orthology

Experimental context differences:

  • Pathogen lifestyle: RLK902 shows opposite roles against necrotrophic vs. biotrophic pathogens

  • Genetic background: Effects may be modified by other genes in different species

  • Environmental conditions: Temperature, humidity, and light can affect defense phenotypes

Reconciliation strategies:

  • Conduct cross-species complementation experiments (e.g., express rice OsRLK902 in Arabidopsis rlk902 mutant)

  • Compare detailed biochemical mechanisms (phosphorylation targets, interaction partners)

  • Test responses to identical pathogens across species when possible

  • Examine evolutionary history of interacting partners

Case study analysis:
In Arabidopsis and B. napus, RLK902 negatively regulates resistance to necrotrophic fungi , while in rice, OsRLK902-1/2 positively regulates resistance to the hemibiotrophic fungus M. oryzae . This apparent contradiction can be reconciled by understanding that:

  • Different pathogens typically trigger distinct defense pathways

  • JA-mediated defenses are primarily effective against necrotrophs

  • Rice blast resistance often involves both SA and JA/ET pathways

  • The specific downstream components may differ between species

By considering these factors, researchers can develop unified models that accommodate species-specific variations while identifying conserved core mechanisms.

What statistical approaches are most appropriate for analyzing RLK902-related phenotypic data?

For disease resistance phenotyping:

  • Two-way ANOVA: For comparing genotypes across different time points or treatments

  • Student's t-test: For comparing two genotypes under a single condition

  • Tukey's HSD or Dunnett's test: For multiple comparisons involving several genotypes

  • Sample sizes: Minimum n=10 plants per genotype, with at least 3 biological replicates

For gene expression analysis:

  • Relative expression using 2^(-ΔΔCT) method with appropriate reference genes (e.g., Ubiquitin for rice )

  • Log transformation of expression data before statistical analysis

  • False Discovery Rate (FDR) correction for transcriptome-wide studies

Analysis of genetic association data:

  • Mixed linear models incorporating population structure for GWAS

  • Linkage disequilibrium analysis to identify haplotype blocks

  • Bonferroni or FDR correction for multiple testing

Protein interaction quantification:

  • Intensity measurements from multiple independent experiments (n≥3)

  • Appropriate normalization to total protein or internal controls

  • Non-parametric tests if normal distribution cannot be assumed

Specific examples from literature:

  • For lesion area measurements from detached leaf assays, data from at least 6 leaves were analyzed using Student's t-test

  • For comparative transcriptomics, DEGs were identified using adjusted p-value < 0.05 and fold change ≥ 2.0

  • For GWAS in B. napus, 170 accessions were analyzed to identify significant SNPs in RLK902

When reporting results, include:

  • Exact p-values (rather than simply p<0.05)

  • Effect sizes and confidence intervals

  • Clear descriptions of statistical tests used

  • Raw data in supplementary materials when possible

What are the most promising areas for future research on RLK902?

Based on current knowledge gaps and recent findings, several research directions offer significant potential:

  • Structural biology of RLK902 complexes

    • Solve crystal structures of RLK902's extracellular domain to identify potential ligands

    • Determine the structural basis for differential activity of natural RLK902 variants

    • Characterize conformational changes upon activation/phosphorylation

  • Identification of upstream signals

    • Identify potential ligands that bind the extracellular domain

    • Determine if RLK902 forms complexes with pattern recognition receptors

    • Investigate whether RLK902 directly perceives damage-associated molecular patterns

  • Comprehensive phosphoproteomics

    • Identify all phosphorylation targets of RLK902 beyond BSK1

    • Map the complete RLK902-dependent phosphorylation cascades

    • Determine how these phosphorylation events regulate downstream responses

  • Biotechnological applications

    • Develop RLK902 variants with enhanced pathogen recognition capabilities

    • Use genome editing to modulate RLK902 activity for improved crop resistance

    • Transfer successful RLK902 haplotypes across crop species

  • Field validation in crops

    • Test if BnaA05.RLK902 knockout lines maintain enhanced resistance without yield penalties under field conditions

    • Evaluate RLK902-modified crops against multiple pathogens simultaneously

    • Assess durability of resistance across growing seasons and environments

The most promising immediate direction appears to be translating the successful CRISPR-based modification of BnaA05.RLK902 from laboratory studies to field applications in B. napus and other Brassica crops , as this could provide a practical solution for managing necrotrophic diseases without compromising yield.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.