Recombinant Arabidopsis thaliana Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 (ICMEL1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2505191
Source
in vitro E.coli expression system
Synonyms
ICMEL1; At1g26120; F14G11.9; F28B23.20; Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1; Isoprenylcysteine methylesterase-like protein 1
Quick Inquiry

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag is required, please inform us for preferential development.
Synonyms
ICMEL1; At1g26120; F14G11.9; F28B23.20; Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1; Isoprenylcysteine methylesterase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-476
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ICMEL1
Target Protein Sequence
MPSQILQISHHLPPKSSPSTEMMFKSLIYDDPSTTLLSRFGDDHHTISSTVKPLLSRSSS YNGTAMKTSSSSSAGGFTGWYQNRRRRSNSDNCLSAFSDDTNGTADGGNNSGDRQTTIGQ EVGHAAAETFLLTRLCLKLLSYLGVGYRWITRFMALGCYAFLLMPGFIQVGYYYFFSPYV RRSIVYGDQPRNRLDLYLPKNSTGPKPVVAFVTGGAWIIGYKAWGSLLGQQLSERDIIVA CIDYRNFPQGSISDMVKDASSGISFVCNHIAEYGGDPDRIYLMGQSAGAHIAACTIVEQV IKESGEGDSVSWSSSQINAYFGLSGGYNLLNLVDHFHSRGLYRSIFLSIMEGEESLRQFS PELVVQNPNLKHIIARLPPFILFHGTDDYSIPSDASKSFAETLQRLGAKAKVILYEGKTH TDLFLQDPMRGGIDEMFEDIVTVVLGDDQEAIGKSVDRRRLVPEFMLKLAHWVSPF
Uniprot No.
Q8VYP9

Target Background

Function
This recombinant Arabidopsis thaliana protein, Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 (ICMEL1), catalyzes the demethylation of isoprenylcysteine methylesters and may play a role in regulating abscisic acid (ABA) signaling.
Gene References Into Functions
  1. Heat stress significantly upregulated the ICME gene but downregulated the ICMEL1 and ICMEL2 genes. PMID: 20868530
Database Links

KEGG: ath:AT1G26120

STRING: 3702.AT1G26120.1

UniGene: At.28380

Protein Families
AB hydrolase superfamily, Isoprenylcysteine methylesterase family
Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, rosette and cauline leaves, stems, flowers and siliques.

Q&A

FAQs for Researchers on Recombinant Arabidopsis thaliana ICMEL1

Advanced Research Questions

  • How do structural variations in ICMEL1 affect substrate specificity?

    • Domain analysis: The C-terminal catalytic domain (residues 200–476) is critical for binding isoprenylated substrates. Mutagenesis of residues in the hydrophobic pocket (e.g., Phe342, Leu389) alters substrate affinity .

    • Comparative modeling: Use AlphaFold-predicted structures (UniProt: Q8VYP9) to guide site-directed mutagenesis .

  • What strategies address contradictions in ICMEL1’s in vitro vs. in planta activity data?

    • Post-translational modifications: Arabidopsis ICMEL1 may undergo phosphorylation (e.g., at Ser15) in planta, which is absent in E. coli-expressed protein .

    • Cofactor requirements: Test activity with plant-specific cofactors (e.g., glutathione) to mimic in vivo conditions .

  • How can genomic instability in expression systems impact ICMEL1 production?

    • TE-mediated mutations: Transposable elements (TEs) in A. thaliana accessions (e.g., Ler-1) may alter regulatory regions of ICMEL1 homologs. Use TE-free strains or stabilize plasmids with par loci .

    • Genome reduction: Deletion of non-essential regions (e.g., rocDEF-rocR in Bacillus subtilis) improves enzyme yield by 30–50%, a strategy adaptable to E. coli .

Methodological Recommendations

  • Storage: Lyophilized ICMEL1 retains activity for 6 months at -80°C. Avoid freeze-thaw cycles; aliquot with 50% glycerol for long-term storage .

  • Thermal stability: Activity declines sharply above 60°C. Pre-incubate at 4–25°C for assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.