Recombinant Arabidopsis thaliana Probable leucine-rich repeat receptor-like protein kinase At5g05160 (At5g05160)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At5g05160; K2A11.3; Probable leucine-rich repeat receptor-like protein kinase At5g05160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-640
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g05160
Target Protein Sequence
DLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVGLYG SIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLPSIS KQLVVLDLSYNSLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLS GPIPEHLKKSPEYSFIGNSLLCGPPLNACSGGAISPSSNLPRPLTENLHPVRRRQSKAYI IAIVVGCSVAVLFLGIVFLVCLVKKTKKEEGGGEGVRTQMGGVNSKKPQDFGSGVQDPEK NKLFFFERCNHNFDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASKKEF EQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRGDRGVDWETRM KIATGTSKAISYLHSLKFVHGDIKSSNILLTEDLEPCLSDTSLVTLFNLPTHTPRTIGYN APEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPGLEDERVVIDLPRWVRSVVREEWT AEVFDVELLKFQNIEEEMVQMLQLALACVARNPESRPKMEEVARMIEDVRRLDQSQQLQQ NRTSSEATSNVSE
Uniprot No.

Target Background

Function
Probable leucine-rich repeat receptor-like protein kinase.
Gene References Into Functions
  1. The receptor-like kinases MORE LATERAL GROWTH1 (MOL1) and REDUCED IN LATERAL GROWTH1 (RUL1) are antagonistic regulators of cambium activity. [RUL1] PMID: 21379334
Database Links

KEGG: ath:AT5G05160

STRING: 3702.AT5G05160.1

UniGene: At.28178

Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Structural and Functional Characterization

Q1: What defines the structural and functional uniqueness of At5g05160 compared to other LRR-RKs? A1: At5g05160 is part of the 225-member LRR-RK family in Arabidopsis, characterized by an extracellular leucine-rich repeat (LRR) domain and an intracellular kinase domain. Its LRR domain facilitates protein-protein interactions, while the kinase domain mediates downstream signaling. Unlike receptors like BRI1 or FLS2, At5g05160 may lack established ligand-binding partners, necessitating interaction mapping via sensitized assays (e.g., yeast two-hybrid or co-immunoprecipitation) to identify coreceptors or ligands .

Q2: How should I validate interactions between At5g05160 and other signaling components? A2: Use orthogonal methods:

  • Co-immunoprecipitation (Co-IP): Confirm physical interactions in planta or heterologous systems (e.g., Nicotiana benthamiana).

  • Yeast Two-Hybrid (Y2H): Map interaction regions (e.g., LRR vs. kinase domains).

  • Live-cell imaging: Track subcellular localization (plasma membrane vs. endosomes) using fluorescent tags .

Experimental Design and Data Analysis

Q3: What challenges arise when designing high-throughput interaction studies for At5g05160? A3:

ChallengeSolution
Orientation biasTest reciprocal bait-prey configurations (e.g., At5g05160 as bait and prey) .
False positivesApply stringent statistical thresholds (e.g., p < 0.05, Z-score > 3) .
Unidirectional signalsValidate unidirectional interactions with orthogonal assays (e.g., fluorescence complementation) .

Q4: How do I resolve contradictions between interaction data from different studies? A4: Compare datasets using a tiered approach:

  • Bidirectional interactions: Prioritize interactions confirmed in both orientations (e.g., At5g05160 ↔ BAK1) .

  • Unidirectional signals: Investigate context-specific activation (e.g., ligand presence, phosphorylation states) .

  • Evolutionary conservation: Analyze homologs in other Brassicaceae species to identify conserved partners .

Signaling Mechanisms and Pathways

Q5: What receptor activation mechanisms are hypothesized for At5g05160? A5: Similar to BRI1/BAK1 or FLS2/BAK1 complexes, At5g05160 may:

  • Recruit coreceptors: LRR domains mediate binding to BAK1 or other LRR-RKs via extracellular interactions .

  • Trigger kinase transphosphorylation: Ligand binding induces conformational changes, enabling autophosphorylation and downstream signaling .

  • Regulate trafficking: Interactions with clathrin adaptors (e.g., TPLATE, AP-4) may control receptor endocytosis and degradation .

Q6: How does At5g05160 contribute to immune or developmental pathways? A6: Hypothesize based on homology:

PathwayPotential Role
Immune signalingRecognition of pathogen-associated molecular patterns (PAMPs) via LRR-mediated binding .
DevelopmentRegulation of cell growth or differentiation through interactions with auxin or steroid receptors .

Evolutionary and Functional Divergence

Q7: What distinguishes At5g05160 from evolutionarily conserved LRR-RKs? A7:

FeatureConservedDivergent
LRR domainCore structural motifs for ligand binding Specific residues modulating binding affinity .
Kinase activityPhosphotransfer signaling Substrate specificity (e.g., RIN4, BIK1) .
Trafficking adaptorsAP-2, TPLATE complex AP-4 recruitment in plants .

Q8: How can GWAS or mutagenesis studies inform At5g05160’s role in stress responses? A8:

  • GWAS: Map QTLs linking At5g05160 polymorphisms to phenotypes (e.g., virus resistance, drought tolerance) .

  • CRISPR editing: Generate null mutants and screen for hypersusceptibility to pathogens or developmental defects .

  • Proteomic profiling: Identify interacting proteins (e.g., E3 ligases, phosphatases) in stress conditions .

Methodological Challenges

Q9: How should I handle conflicting interaction data from Y2H vs. Co-IP? A9:

  • Y2H artifacts: Overcome by normalizing for auto-activation and confirming with in planta validation .

  • Co-IP limitations: Use denaturing buffers to disrupt transient interactions and focus on stable complexes .

  • Kinase activity: Measure phosphorylation events (e.g., immunoblotting with anti-pSer/Thr) to confirm functional interactions .

Q10: What computational tools are essential for analyzing At5g05160 interaction networks? A10:

ToolApplication
STRINGPredict interactome based on homology .
CytoscapeVisualize and annotate interaction networks.
MEMEIdentify conserved motifs in LRR domains .

Future Research Directions

Q11: What unresolved questions warrant further investigation? A11:

  • Ligand identification: Use phage display or chemical genomics to discover endogenous ligands.

  • Synthetic biology: Engineer At5g05160 variants with enhanced signaling output for crop improvement.

  • Non-canonical pathways: Explore roles in abiotic stress (e.g., salinity, temperature) beyond immune/developmental axes .

Q12: How can single-cell RNA-seq inform tissue-specific signaling roles? A12: Profile At5g05160 expression across root, shoot, and leaf cells to identify niche-specific functions (e.g., root hair elongation vs. stomatal guard cell signaling) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.