Recombinant Arabidopsis thaliana Probable lipid desaturase ADS3.2, chloroplastic (ADS3.2)

Shipped with Ice Packs
In Stock

Description

Gene Family Context

ADS3.2 belongs to the Arabidopsis ADS (acyl-CoA desaturase-like) gene family, which encodes nine proteins with homology to Δ9 acyl-lipid desaturases . Key distinctions include:

  • ADS3.2 (At3g15870) vs. ADS3 (At3g15850/FAD5): ADS3.2 is a distinct gene adjacent to ADS3 (FAD5), which is known for Δ7 desaturation in plastidic lipids .

  • Functional Divergence: While ADS3/FAD5 is plastid-localized and Δ7-specific, ADS3.2 lacks a chloroplast transit peptide, suggesting alternative subcellular localization or substrate specificity .

Enzymatic Function and Mechanism

ADS3.2’s enzymatic activity remains partially characterized, but its homology to Δ9 acyl-CoA desaturases implicates roles in:

  • Very-long-chain fatty acid (VLCFA) desaturation: Similar to ADS1 and ADS2, which introduce double bonds at n-9 positions (e.g., 24:1(n-9), 26:1(n-9)) in seed lipids and sphingolipids .

  • Regiospecificity Modulation: Subcellular environment influences desaturation position. For example, ADS enzymes in plastids (e.g., with MGDG) catalyze Δ7 desaturation, while extraplastidial targeting shifts activity to Δ9 .

Hypothetical Role of ADS3.2:

  • Potential involvement in Δ9 desaturation of acyl-CoA substrates, contributing to membrane lipid diversity or stress responses.

  • Genetic studies link nearby loci (e.g., QTL3) to fatty acid composition, though direct evidence for ADS3.2’s role is pending .

Genetic and Phenotypic Studies

  • QTL Mapping: ADS3.2 is located near QTL3, associated with fatty acid variation in seeds, suggesting a genetic link to lipid metabolism .

  • Mutant Phenotypes: No overt phenotypes in Arabidopsis under standard conditions, but targeted studies (e.g., in fab1/fae1 mutants) may reveal functional redundancy .

Experimental Tools

Recombinant ADS3.2 is used in:

ApplicationMethodOutcome
Enzymatic AssaysHeterologous expression in yeast or E. coliIdentification of substrate specificity
Protein PurificationHis-tag affinity chromatographyHigh-purity protein for biochemical studies
Structural AnalysisSDS-PAGE, Western blottingConfirmation of size and purity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADS3.2; At3g15870; MSJ11.26; Probable lipid desaturase ADS3.2, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
58-361
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ADS3.2
Target Protein Sequence
AVYEAPDHVESSWRRLLSEVVVVRTKRSFWERSWTSWDVSKLVIFVGTHLLSLLAPFYFS WEAFWVFPWLVFINGICITLSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNH RYHHKHCETQRDPHSPTQGFWFSHMAWIFDTSSILENCGGEENVDDLVRQPFYRFLQRTV LLHMMAYSFLFYFCGGMPLLVWGIGITIAVRLHLTFLVNSVCHIWGTRAWNTSDFSKNNW WVAILTLGEGWHNNHHAFEFSARHGLEWWQLDITWCLIRFLEAIGLATNVKLPTETQMKG KALV
Uniprot No.

Target Background

Gene References Into Functions
  1. Mutation at this site does not affect the activity of the plastidial palmitoyl-monogalactosyldiacylglycerol Δ7-desaturase FAD5. PMID: 15579662
Database Links

KEGG: ath:AT3G15870

STRING: 3702.AT3G15870.1

UniGene: At.26150

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural and functional characterization of ADS3.2 within the Arabidopsis ADS family?

    ADS3.2 (At3g15870) belongs to the acyl-CoA desaturase-like (ADS) gene family of Arabidopsis, which contains nine members encoding fatty acid desaturase-like proteins. ADS3.2 is closely linked to AtADS3/FAD5 (At3g15850) on chromosome III, and both are the only family members predicted to encode proteins with a chloroplast transit peptide .

    The protein contains the characteristic His box motifs found in fatty acid desaturases and features the putative Δ9 FAD-like conserved domain (cd03505) . Structurally, ADS3.2 has an extra 64 amino acids at its N-terminus compared with other ADS family members, suggesting potential differences in subcellular targeting and function .

    Sequence characteristics of ADS3.2:

    FeatureDescription
    Gene IDAt3g15870
    Alternative namesMSJ11.26, MSJ11.4, MSJ11_27
    Protein lengthFull mature protein (aa 58-361)
    Predicted localizationChloroplastic
    DomainΔ9 FAD-like conserved domain
    UniProt IDQ9LVZ3
  • How should researchers approach expression and purification of recombinant ADS3.2 protein?

    For successful expression and purification of recombinant ADS3.2:

    1. Expression system selection: E. coli has been successfully used for ADS3.2 expression with an N-terminal His tag for the mature protein (aa 58-361) . Alternative systems like yeast (S. cerevisiae) may be considered for functional studies, as demonstrated with other ADS family members .

    2. Purification strategy: Metal affinity chromatography using the His tag is recommended. The purified protein achieves >90% purity as determined by SDS-PAGE .

    3. Storage recommendations: Store the lyophilized powder at -20°C/-80°C upon receipt. For reconstitution, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration, then add glycerol to 50% final concentration and aliquot for long-term storage at -20°C/-80°C. For working solutions, store at 4°C for up to one week and avoid repeated freeze-thaw cycles .

  • What is known about the phylogenetic relationships between ADS3.2 and other ADS family members?

    The ADS gene family shows interesting evolutionary relationships:

    1. ADS3.2 is most closely related to AtADS3/FAD5, with both containing an N-terminal chloroplast transit peptide, setting them apart from other family members that are predicted to be located in the endoplasmic reticulum (ER) membrane .

    2. The remaining ADS genes are located in three clusters on chromosomes I and II, with ADS2 (At2g31360) on chromosome II and the rest on chromosome I .

    3. Among other family members, AtADS1.2 and AtADS1.4 show the highest conservation with 89.6% amino acid identity, followed by AtADS4 and AtADS4.2 with 81.3% identity. AtADS1 and AtADS2 share 75.9% identity .

    This phylogenetic organization suggests subfunctionalization and potential neofunctionalization among family members, with ADS3.2 potentially serving a specialized role in chloroplastic lipid metabolism .

Advanced Research Questions

  • What experimental designs are most effective for studying ADS3.2 function in vivo?

    To study ADS3.2 function in vivo, consider implementing a two-phase experimental design approach:

    Phase 1: Genetic manipulation

    • Gene knockout strategy: Generate CRISPR-Cas9 or T-DNA insertion mutants of ADS3.2. For comparison, also create knockout lines of other ADS family members to assess functional redundancy .

    • Overexpression approach: Generate lines expressing ADS3.2 under control of either tissue-specific promoters (e.g., seed-specific napin promoter) or constitutive promoters (e.g., CaMV 35S), similar to approaches used with AtADS1 and AtADS2 .

    Phase 2: Comprehensive phenotypic and biochemical analysis

    Implement a randomized incomplete block design (α-design) with multiple replicates to analyze:

    1. Lipid profile changes using:

      • Fatty acid methyl ester (FAME) analysis by GC

      • LC-MS/MS for complex lipid analysis

      • Acyl-CoA profiling

    2. Growth phenotype analysis under:

      • Normal conditions

      • Temperature stress (particularly cold stress, as ADS family members show temperature-responsive expression)

      • Drought stress

    This experimental design should be optimized across both phases to minimize the MVD (minimum variance of difference) between genotype estimates. Consider using the approach detailed by Molenaar et al. (2017), which demonstrated that design generation across phases (rather than phase-wise) yields the smallest MVD .

  • How can researchers accurately determine the substrate specificity and regiospecificity of ADS3.2?

    A comprehensive approach to determining ADS3.2 substrate specificity should include:

    1. Heterologous expression systems:

      • Express ADS3.2 in yeast (S. cerevisiae) mutants lacking endogenous desaturase activity

      • Supply various potential fatty acid substrates of different chain lengths (C16-C26)

      • Analyze products by GC-MS of FAMEs and compare against standards

    2. In vitro enzyme assays:

      • Purify recombinant ADS3.2 protein

      • Test activity with acyl-lipid and acyl-CoA substrates to determine preference

      • Use position-specific analysis techniques (GC-MS of derivatives) to determine regiospecificity

    3. Organelle-specific assays:

      • Since ADS3.2 is chloroplastic, consider chloroplast isolation and in organello assays

      • Compare with activity of AtADS3/FAD5, which has known Δ7 desaturase activity on palmitoyl-MGDG

    Based on studies of related ADS proteins, expect ADS3.2 to potentially show Δ7 or Δ9 desaturase activity, possibly on very-long-chain fatty acid (VLCFA) substrates, with regiospecificity influenced by the fatty acid substrate .

  • What approaches should be used to investigate the physiological role of ADS3.2 in plant stress responses?

    To investigate ADS3.2's role in stress responses:

    1. Stress-specific expression profiling:

      • Conduct qRT-PCR analysis of ADS3.2 expression under various stresses (cold, drought, heat)

      • Compare with expression patterns of AtADS2, which is regulated in response to temperature changes

    2. Stress tolerance phenotyping:

      • Subject ADS3.2 knockout and overexpression lines to temperature stress, particularly cold stress (6°C), which has been shown to affect growth in ads2 mutants

      • Perform drought tolerance assays, as ADS family members have been implicated in drought tolerance

    3. Membrane integrity analysis:

      • Analyze lipid composition changes in chloroplast membranes under stress conditions

      • Measure membrane fluidity changes using fluorescence anisotropy or electron paramagnetic resonance spectroscopy

      • Correlate lipid changes with physiological responses

    4. Comparative analysis with ADS2:

      • ADS2-deficient plants show no obvious phenotype under normal conditions but exhibit clear sensitivity to cold exposure at 6°C

      • Design parallel experiments with ADS3.2 and ADS2 mutants to determine if they have complementary or overlapping functions in stress response

    Experimental design considerations:
    Use a factorial design with genotype (wild-type, knockout, overexpression) and treatment (control, cold, drought) as factors, with appropriate replication to achieve statistical power. Include internal validation controls and use combined inter-block-intra-block analysis to minimize variance in your data interpretation .

  • How can researchers resolve technical challenges in analyzing ADS3.2 enzymatic activity in complex lipid environments?

    Analyzing desaturase activity in complex lipid environments presents several technical challenges. Here's a methodological approach to address them:

    1. Substrate preparation challenges:

      • For chloroplastic lipids, synthesize or isolate MGDG substrates with appropriate acyl chains

      • Label substrates with stable isotopes (13C or deuterium) to track desaturation products

      • Consider using synthetic liposomes or native membrane preparations

    2. Assay optimization:

      • Test multiple buffers, pH ranges, and cofactor concentrations (oxygen, ferredoxin, NADPH)

      • Optimize temperature conditions (likely 25-30°C for plant enzymes)

      • Use appropriate detergents to solubilize membrane-bound substrates without inactivating the enzyme

    3. Product analysis approaches:

      • Use mild saponification to separate products from complex lipids

      • Employ both GC-MS and LC-MS/MS for comprehensive product identification

      • Distinguish between acyl-CoA and acyl-lipid desaturation products

    4. Control experiments:

      • Compare with known desaturases (e.g., AtADS3/FAD5)

      • Use boiled enzyme controls

      • Perform parallel assays with microsomes from knockout plants versus wild type

    When interpreting results, be aware that activity observed in heterologous systems may differ from in planta activity due to differences in membrane environment, cofactor availability, and post-translational modifications.

  • What is the current understanding of the relationship between ADS3.2 function and chloroplast lipid homeostasis?

    The relationship between ADS3.2 and chloroplast lipid homeostasis remains an area requiring further investigation, but current understanding suggests:

    1. Potential role in chloroplast membrane adaptation:

      • Given its chloroplastic localization and predicted desaturase activity, ADS3.2 likely contributes to adjusting chloroplast membrane fluidity

      • Its close relationship with AtADS3/FAD5, which desaturates 16:0 to 16:1Δ7 on MGDG, suggests a possible role in galactolipid metabolism

    2. Comparison with AtADS3/FAD5 function:

      • AtADS3/FAD5 is responsible for Δ7 desaturation of 16:0 on MGDG at the sn-2 position in chloroplasts

      • ADS3.2 may have complementary or overlapping function, possibly with different substrate specificity or regiospecificity

    3. Potential implications for thylakoid membrane organization:

      • Altered desaturation of chloroplast lipids affects thylakoid membrane architecture and photosynthetic complex organization

      • ADS3.2 may be involved in stress-responsive adjustments to chloroplast membranes

    Research approach recommendation:
    Combine lipidomic analysis of chloroplast membrane fractions from wild-type and ads3.2 mutant plants with electron microscopy to correlate lipid changes with structural alterations in chloroplast membranes. Include analysis under various environmental conditions (temperature, light intensity) to identify condition-specific functions.

  • What bioinformatic approaches are most effective for predicting ADS3.2 structure-function relationships?

    To predict ADS3.2 structure-function relationships:

    1. Sequence-based analysis:

      • Multiple sequence alignment of ADS3.2 with characterized desaturases, focusing on His-box motifs characteristic of fatty acid desaturases

      • Conservation analysis across species to identify functionally important residues

      • Analysis of the putative Δ9 FAD-like conserved domain (cd03505)

    2. Structural modeling:

      • Homology modeling using solved structures of related desaturases

      • Molecular dynamics simulations to predict protein-membrane interactions

      • Docking studies with potential substrates to predict binding modes

    3. Machine learning approaches:

      • Use of neural networks to predict substrate specificity based on sequence features

      • Identification of substrate tunnels and binding pockets

    4. Integration with experimental data:

      • Map experimental data from mutagenesis studies onto structural models

      • Use structure-guided design of mutations to test function

    Example workflow for structure prediction:

    StepMethodExpected Outcome
    1BLAST/HMM searchIdentification of closest homologs with known function
    2Multiple sequence alignmentIdentification of conserved motifs and residues
    3Secondary structure predictionTopology map of ADS3.2 in membrane
    4Homology modeling3D structural model
    5Model validationQuality assessment using metrics like QMEAN, ProSA
    6Substrate dockingPrediction of substrate binding residues
    7Molecular dynamics simulationRefinement of model in membrane environment

    This integrated bioinformatic approach should provide testable hypotheses regarding the structural features determining ADS3.2's substrate specificity and regiospecificity.

  • How can researchers design effective experiments to study potential redundancy between ADS3.2 and other ADS family members?

    To study functional redundancy in the ADS family:

    1. Generate genetic resources:

      • Create single knockouts of ADS3.2 and other ADS genes

      • Generate double and higher-order mutants, focusing on combinations with AtADS3/FAD5 (the closest homolog)

      • Develop complementation lines expressing various ADS genes under the ADS3.2 promoter

    2. Comprehensive phenotyping:

      • Compare growth, development, and stress responses across mutant combinations

      • Perform detailed lipidomic analysis under multiple conditions

      • Use statistical approaches to identify synergistic vs. additive effects in multiple mutants

    3. Cross-complementation analysis:

      • Express ADS3.2 in ads3/fad5 background and vice versa

      • Test if other ADS genes can compensate for ADS3.2 function when directed to the chloroplast

      • Analyze if ADS3.2 can complement phenotypes of other ads mutants when targeted to the ER

    4. Expression correlation analysis:

      • Perform co-expression network analysis to identify genes with expression patterns correlated with ADS3.2

      • Analyze promoter elements for shared regulatory features

    This experimental design should help distinguish between true functional redundancy (where proteins perform the same biochemical function) and compensatory effects (where different biochemical activities produce similar physiological outcomes).

  • What approach should researchers take to investigate the role of ADS3.2 in very-long-chain fatty acid (VLCFA) metabolism?

    To investigate ADS3.2's potential role in VLCFA metabolism:

    1. Analysis of VLCFA profiles in mutant plants:

      • Perform comprehensive lipid analysis in ads3.2 single and multiple mutants, focusing on VLCFA-containing lipids

      • Compare with profiles from other ads mutants, particularly ads1 and ads2, which have demonstrated effects on 24:1(n-9) and 26:1(n-9) levels

    2. In vitro activity assays:

      • Test purified ADS3.2 activity on VLCFA substrates

      • Compare desaturase activity on free fatty acids, acyl-CoAs, and lipid-bound VLCFAs

      • Determine position of double bond introduction (regiospecificity)

    3. Flux analysis:

      • Use stable isotope labeling to track VLCFA synthesis and modification pathways

      • Compare incorporation rates in wild-type versus mutant plants

    4. Subcellular localization studies:

      • Verify chloroplast localization using fluorescent protein fusions

      • Investigate potential dual targeting to other compartments

      • Determine if ADS3.2 can access VLCFA pools despite chloroplastic localization

    The research should address the apparent paradox of a chloroplast-localized enzyme potentially acting on VLCFAs, which are typically synthesized in the ER. Current evidence for other ADS family members indicates that 24-carbon and 26-carbon monounsaturated VLCFAs result primarily from VLCFA desaturation rather than by elongation of long-chain monounsaturated fatty acids .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.