Recombinant Arabidopsis thaliana Probable long-chain-alcohol O-fatty-acyltransferase 5 (AT5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AT5; At5g55340; MTE17.5; Probable long-chain-alcohol O-fatty-acyltransferase 5; Wax synthase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AT5
Target Protein Sequence
MDEELKNLIKVWVSAIISISYCYYIPPRIKSGAPRFLSVSPVLALFLVLPLFFSSLHLSL ITAFFLTWLANFKLILFSFDKGPLIPIPTNFPRFFCFTCFPIKVQQNPKSQNHLPKLVFA IKLAIFAVLLHLYSYRQNLSPTILLGLYFVHLYLEIEIILTFVKVVVFISLGCDLEPQSN KPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERKMSSGWALFPGILAAFIVSGLV HELLFFYLIREMPTGEVTLFFVLHGVCTAVELAVKKKTTVAQRWRLSPGVSRVLTVGFVF VTGGWLFTPQLKRSGVMERFTSEAVLLVEFIKR
Uniprot No.

Target Background

Function

Function: Catalyzes the final step in the biosynthesis of long-chain linear esters (waxes).

Database Links

KEGG: ath:AT5G55340

STRING: 3702.AT5G55340.1

UniGene: At.64300

Protein Families
Wax synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is AT5 and what is its function in Arabidopsis thaliana?

AT5 (At5g55340) is identified as a probable long-chain-alcohol O-fatty-acyltransferase in Arabidopsis thaliana, also known as Wax synthase 5 . The protein is involved in the biosynthesis of wax esters, which are important components of the plant cuticle. AT5 catalyzes the transfer of acyl groups from fatty acyl-CoAs to long-chain alcohols, forming wax esters that contribute to the plant's surface protection against environmental stresses, pathogens, and water loss. The gene encoding AT5 is located on chromosome 5 of Arabidopsis thaliana, which contains 5,874 genes and represents approximately 21% of the sequenced regions of the Arabidopsis genome .

The function of AT5 can be understood in the broader context of Arabidopsis acyltransferases, which play diverse roles in plant metabolism. Other acyltransferases in Arabidopsis, such as BR-related acyltransferase 1 (AtBAT1), are involved in brassinosteroid metabolism and affect plant growth and development . Understanding the specific role of AT5 requires comparative analysis with these functionally characterized acyltransferases, although AT5's activity is directed toward wax biosynthesis rather than hormone regulation.

How is recombinant AT5 protein typically produced for research purposes?

Recombinant AT5 protein can be produced using various expression systems, with E. coli being the most common as evidenced by the commercially available recombinant AT5 . For AT5 expression in E. coli, the protein coding sequence is typically cloned into expression vectors with inducible promoters such as pET or pBAD series, often fused with affinity tags like His-tag for easier purification.

The methodology involves:

  • Amplifying the AT5 gene from Arabidopsis thaliana cDNA using specific primers with appropriate restriction sites (similar to the approach used for AtBAT1 gene amplification with XbaI and SmaI restriction sites)

  • Cloning the amplified gene into an expression vector (such as pCAMBIA3300 used for AtBAT1)

  • Transforming the recombinant plasmid into an E. coli expression strain (commonly BL21(DE3) or derivatives)

  • Inducing expression using appropriate conditions (temperature, inducer concentration)

  • Harvesting cells and extracting the recombinant protein

According to available product information, recombinant AT5 has been successfully expressed in E. coli as a full-length protein (1-333 amino acids) with an N-terminal His tag . For membrane-associated proteins like AT5, expression optimizations may include lower induction temperatures (15-25°C), reduced inducer concentrations, and specialized E. coli strains designed for membrane protein expression.

What are the recommended purification and storage conditions for recombinant AT5?

Since commercially available recombinant AT5 is typically His-tagged , affinity chromatography using Ni-NTA or similar metal affinity resin is the primary purification method. The purification protocol generally involves:

  • Cell lysis using methods appropriate for the expression system (sonication, enzymatic lysis, or pressure homogenization)

  • For membrane-associated proteins like AT5, solubilization with appropriate detergents

  • Clarification of the lysate by centrifugation

  • Affinity chromatography using the His-tag

  • Washing to remove non-specifically bound proteins

  • Elution using imidazole gradient or pH change

  • Additional purification steps if needed (ion exchange, size exclusion chromatography)

According to the storage information provided for commercially available recombinant AT5, the optimal storage conditions include:

  • Storage at -20°C/-80°C for long-term preservation

  • Aliquoting to avoid repeated freeze-thaw cycles (repeated freezing and thawing is not recommended)

  • Addition of glycerol (recommended final concentration of 50%) for cryoprotection

  • Storage buffer consisting of Tris/PBS-based buffer with 6% trehalose at pH 8.0

For working aliquots, storage at 4°C for up to one week is recommended . Prior to use, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . These storage parameters help maintain protein stability and activity for research applications.

What experimental approaches can be used to study AT5 enzymatic activity?

For characterizing AT5 enzymatic activity, researchers can employ several sophisticated approaches:

  • Radiochemical assays: Using radiolabeled substrates (14C-labeled fatty acyl-CoAs or alcohols) to track the formation of wax esters, similar to the approach used for ADP-glucose phosphorylase with ADP-[14C]glucose

  • LC-MS/MS analysis: To identify and quantify reaction products with high sensitivity and specificity

  • Coupled spectrophotometric assays: Measuring CoA release during the acyltransferase reaction

  • Activity-based protein profiling (ABPP): Similar to approaches used for other plant enzymes, such as the use of DCG-04 for labeling papain-like Cys proteases

A comprehensive enzymatic characterization would include:

  • Substrate specificity testing with various fatty acyl-CoA donors and long-chain alcohol acceptors

  • Determination of optimal reaction conditions (pH, temperature, ionic strength)

  • Kinetic parameter analysis (Km, Vmax, kcat) for preferred substrates

  • Inhibitor studies to identify specific AT5 inhibitors

The ping-pong bi bi kinetic mechanism analysis, as demonstrated for the ADP-glucose phosphorylase described in the literature (with kcat = 4.1 s−1 and Km values of 1.4 μM and 83 μM for the substrates) , provides a methodological framework that can be adapted for AT5 kinetic characterization, particularly if the reaction follows a sequential substrate binding and product release pattern.

How can researchers design knockout/knockdown experiments to study AT5 function in vivo?

For studying AT5 function through gene silencing or knockout approaches:

  • CRISPR/Cas9 gene editing:

    • Design guide RNAs targeting AT5 exons

    • Select Arabidopsis transformants with frameshift mutations

    • Verify mutations by sequencing

    • Establish homozygous knockout lines

  • RNAi-mediated knockdown:

    • Design hairpin RNAi constructs targeting AT5-specific sequences

    • Transform Arabidopsis using Agrobacterium-mediated transformation similar to the method used for AtBAT1 overexpression

    • Select transformants and verify knockdown efficiency by RT-qPCR

    • Assess phenotypes in multiple independent lines

  • T-DNA insertion lines:

    • Obtain available T-DNA insertion lines from seed repositories

    • Confirm homozygosity and gene disruption

    • Characterize expression using RT-PCR and protein levels using Western blotting

  • Inducible systems:

    • Use chemical- or temperature-inducible promoters for controlled AT5 silencing

    • Monitor temporal changes in phenotype after induction

For phenotypic analysis of AT5 mutants, researchers should examine:

  • Cuticular wax composition (extract and analyze by GC-MS)

  • Water loss rates from detached leaves

  • Drought resistance phenotypes (similar to the drought tolerance observed in AtBAT1 transgenic plants)

  • Epidermal cell morphology by microscopy

  • Resistance to pathogens and environmental stresses

The methodology used for AtBAT1 overexpression in creeping bentgrass, which resulted in modified BR levels and drought tolerance , provides a useful reference for transgenic approaches in studying acyltransferase function in plants.

What are the recommended protocols for studying AT5 localization in plant cells?

To investigate the subcellular localization of AT5, several complementary approaches are recommended:

  • Fluorescent protein fusion approaches:

    • Generate N- and C-terminal GFP fusions of AT5

    • Express in Arabidopsis under native or constitutive promoters (such as the CaMV 35S promoter used for AtBAT1)

    • Image using confocal microscopy

    • Co-localize with organelle-specific markers (particularly ER and Golgi markers)

  • Immunolocalization:

    • Develop specific antibodies against AT5 or use antibodies against the His-tag in recombinant proteins

    • Perform immunofluorescence on fixed plant tissues

    • Use high-resolution techniques like super-resolution microscopy for detailed localization

  • Subcellular fractionation:

    • Isolate different cellular fractions (plasma membrane, ER, Golgi, etc.)

    • Detect AT5 in fractions by Western blotting

    • Verify fraction purity with marker proteins

  • Electron microscopy:

    • Use immunogold labeling with AT5-specific antibodies

    • Perform transmission electron microscopy for high-resolution localization

As wax biosynthesis enzymes are often associated with the endoplasmic reticulum or plasma membrane, special attention should be paid to these compartments when studying AT5 localization. Researchers should also examine potential changes in localization under different environmental conditions or developmental stages, as localization may be dynamic and regulate AT5 function.

How can researchers design experiments to study AT5 substrate specificity?

To characterize AT5 substrate specificity, researchers should design a comprehensive substrate screening approach:

  • Substrate panel preparation:

    • Acyl-CoA donors of varying chain lengths (C8-C24) and degrees of unsaturation

    • Primary alcohol acceptors with different chain lengths (C12-C32)

    • Structurally modified substrates to probe binding pocket requirements

  • Competition assays:

    • Measure activity with preferred substrate in the presence of potential competitive substrates

    • Calculate IC50 values to rank binding affinities

  • Site-directed mutagenesis:

    • Identify potential substrate-binding residues through homology modeling

    • Create point mutations in these residues

    • Assess changes in substrate preference profiles

  • Analysis and data presentation:

Substrate CombinationRelative Activity (%)Km (μM)kcat (s-1)kcat/Km (M-1s-1)
C16:0-CoA + C16-OH100XYZ
C18:0-CoA + C16-OHAX'Y'Z'
C16:0-CoA + C18-OHBX''Y''Z''
...............

The kinetic mechanism analysis described for ADP-glucose phosphorylase, which follows a ping pong bi bi kinetic mechanism with specific kcat and Km values , provides a methodological framework that could be adapted for AT5 substrate specificity studies. This approach would allow for a comprehensive characterization of AT5's substrate preferences and catalytic efficiency with different substrate combinations.

What approaches can be used to study the role of AT5 in plant stress responses?

To investigate AT5's role in plant stress responses, researchers should consider:

  • Expression analysis under stress conditions:

    • Expose plants to various stresses (drought, salt, cold, heat, pathogen infection)

    • Measure AT5 transcript levels by RT-qPCR

    • Analyze protein accumulation by Western blotting

    • Perform promoter-reporter assays to identify stress-responsive elements

  • Phenotypic analysis of AT5 mutants under stress:

    • Compare wild-type, at5 knockout/knockdown, and AT5 overexpression lines

    • Measure physiological parameters (water loss, photosynthetic efficiency, ROS accumulation)

    • Assess survival rates and recovery after stress

    • Analyze changes in cuticle properties and wax composition

  • Metabolite profiling:

    • Perform comprehensive lipidomics analysis of wild-type and AT5 mutant plants under normal and stress conditions

    • Identify changes in wax ester and related lipid profiles

    • Correlate lipid changes with stress tolerance phenotypes

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify signaling pathways connecting stress perception to AT5 regulation

    • Construct network models of AT5's role in stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.