Recombinant Arabidopsis thaliana Probable long-chain-alcohol O-fatty-acyltransferase 7 (AT7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Probable Long-Chain-Alcohol O-Fatty-Acyltransferase 7 (AT7)

Recombinant Arabidopsis thaliana Probable Long-Chain-Alcohol O-Fatty-Acyltransferase 7 (AT7) is a recombinant protein derived from the model plant Arabidopsis thaliana. This enzyme belongs to the family of transferases, specifically acyltransferases, which are involved in the synthesis of wax esters by transferring acyl groups from acyl-CoA to long-chain alcohols . The recombinant form of AT7 is expressed in E. coli and is fused with a His tag for easier purification and identification .

Characteristics of Recombinant AT7

The recombinant AT7 protein is a full-length protein consisting of 339 amino acids. It is produced in E. coli and is available in a lyophilized powder form. The purity of this protein is greater than 90% as determined by SDS-PAGE, indicating its high quality for research purposes .

Characteristics Table

CharacteristicsDescription
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length (1-339aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C

Function and Role of AT7

Long-chain-alcohol O-fatty-acyltransferases, including AT7, play a crucial role in the synthesis of wax esters, which are important components of plant cuticles. These enzymes catalyze the reaction between acyl-CoA and long-chain alcohols to produce wax esters and CoA . In plants, these wax esters contribute to the formation of the cuticle layer, which helps protect the plant from water loss and environmental stresses.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
AT7; At5g55320; MTE17.3; Probable long-chain-alcohol O-fatty-acyltransferase 7; Wax synthase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AT7
Target Protein Sequence
MEEEIKSLINVGFLTIISVSYCYCLPPRIKSGVLRLLSIFPVCVLLVVLPLFFSFSIFTS TTAFFLSAIANSRLILFSFDQGPLFPLPSNLFRFTCFTCFPIQRQQNPKSQDHLSTYVFP VKIAIFVVLLYVHNDIQNLPRTFLLCLHPLYVYLLLEILLTLLRILMTIILGCDLEPHFH EPYLATSLQDFWGRRWNLIVSASLRAIVYTPVRRVCQRVMSSDYAMLIGVFATFVTSGVA HEVVFFYITRAMPTGEVALFFLLHGVCTVAEVAAKRTAFVRRWPVRPVVSWMFTIAFVNV TAGWLFFPQLIRNNLGERCSNEISLLIDFFRSKLFYFPQ
Uniprot No.

Target Background

Function
Catalyzes the final step in the synthesis of long-chain linear esters (waxes).
Database Links
Protein Families
Wax synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of AT7 in Arabidopsis thaliana defense mechanisms?

Similar to other characterized proteins in Arabidopsis like NUDT7, AT7 likely plays a regulatory role in plant metabolism and defense responses. Based on current understanding of acyltransferases in plants, AT7 may catalyze the transfer of fatty acids to long-chain alcohols, potentially affecting cell membrane composition and permeability during stress responses. Research approaches similar to those used for studying NUDT7 would be appropriate, as NUDT7 has been established as a negative regulator of basal immunity in Arabidopsis, with its loss-of-function mutation resulting in enhanced resistance to pathogens like Pseudomonas syringae .

How can I confirm the expression pattern of AT7 in different tissues?

To confirm AT7 expression patterns:

  • Use qRT-PCR to quantify transcript levels in different tissues

  • Employ RNA-seq for transcriptome-wide expression analysis

  • Develop promoter-reporter constructs (e.g., AT7 promoter:GUS) for histochemical localization

When analyzing expression data, note temporal patterns as seen with NUDT7, which shows low expression in uninfected tissue but significant induction within 0.5 hours of pathogen inoculation, followed by fluctuating expression levels (decreasing at 3 hours post-inoculation before increasing again) .

What approaches can be used to generate AT7 knockout/knockdown mutants?

MethodAdvantagesLimitationsTimeline
T-DNA insertionStable inheritance, complete knockout possibleRequires screening, may affect neighboring genes2-3 generations
CRISPR-Cas9Precise targeting, multiple targets possibleOff-target effects, transformation required1-2 generations
RNA interferenceKnockdown possible when knockout is lethalVariable silencing efficiency, incomplete suppression1-2 generations
TILLINGNo transgenic approach, point mutationsLabor-intensive screening, subtle phenotypes2-3 generations

For identifying AT7 mutants, PCR-based methods similar to those used for verifying the nudt7 T-DNA insertion mutant (Salk_046441) would be appropriate .

How can I investigate potential post-transcriptional regulation mechanisms affecting AT7 expression?

Post-transcriptional regulation represents a significant layer of gene expression control in Arabidopsis. To investigate this for AT7:

  • Analyze alternative polyadenylation sites using 3'RACE (Rapid Amplification of cDNA Ends) techniques. The RPP7 gene in Arabidopsis demonstrates how alternative polyadenylation can critically balance transcript isoforms—a mechanism potentially regulating other genes like AT7 .

  • Examine intron retention and alternative splicing events using RT-PCR with primers spanning intron-exon boundaries.

  • Investigate potential regulatory elements in the 5'UTR and 3'UTR regions using reporter constructs.

  • Assess transcript stability through actinomycin D treatment followed by RNA stability assays.

  • Consider the role of transposable elements within introns, which may influence splicing or polyadenylation, as observed with the COPIA-R7 retrotransposon in RPP7 .

The balance between different transcript isoforms often determines protein abundance and function, making this investigation crucial for understanding AT7 regulation .

What approaches can resolve contradictory data regarding AT7 substrate specificity?

When encountering contradictory data regarding AT7 substrate specificity:

Contradictions often emerge due to subtle differences in methodology or may reflect genuine biological complexity. These contradictions should be embraced as opportunities to uncover nuanced regulatory mechanisms rather than dismissed .

What expression systems are most suitable for obtaining functional recombinant AT7?

Selection of an appropriate expression system is critical for obtaining functional AT7 protein:

Expression SystemAdvantagesLimitationsRecommended Use Case
E. coliFast growth, high yield, inexpensiveLimited post-translational modifications, inclusion body formationInitial characterization, antibody production
Yeast (P. pastoris)Eukaryotic folding, glycosylationLonger expression time, more complex mediaFunctional studies requiring proper folding
Insect cellsNear-native post-translational modificationsHigher cost, specialized equipmentStructural studies, complex functional assays
Plant expression systemsNative modifications, natural cofactorsLower yields, longer timelineIn planta functional validation

For plant-specific proteins like AT7, consider using Arabidopsis cell cultures or Nicotiana benthamiana transient expression to maintain the native cellular environment needed for proper folding and function.

How should I design purification strategies for recombinant AT7?

A systematic purification strategy for AT7 should include:

  • Affinity tag selection considerations:

    • His6-tag: Efficient for IMAC purification but may affect protein activity

    • GST-tag: Enhances solubility but large size may interfere with function

    • FLAG or Strep-tag: Smaller size minimizes interference with enzymatic activity

  • Optimization of lysis conditions:

    • Buffer composition (pH 7.0-8.0 typical for plant enzymes)

    • Presence of reducing agents to maintain cysteine residues

    • Appropriate detergents for membrane-associated proteins

  • Chromatography sequence:

    • Primary: Affinity chromatography based on selected tag

    • Secondary: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to ensure homogeneity

  • Activity preservation measures:

    • Addition of glycerol (10-20%) to maintain protein stability

    • Inclusion of substrate analogs or cofactors to stabilize active conformation

    • Storage at -80°C in single-use aliquots to prevent freeze-thaw cycles

This approach follows principles employed in purification of other Arabidopsis enzymes with similar properties.

How can I analyze contradictory results in AT7 characterization experiments?

When faced with contradictory results in AT7 research:

Remember that "contradictions emerge because there is a subtle difference in meaning" , which may reveal important nuances about AT7 function.

What approaches help interpret AT7 function in the context of plant defense responses?

To interpret AT7 function in plant defense:

  • Conduct phenotypic analysis of AT7 mutants following pathogen challenge, assessing:

    • Disease resistance/susceptibility

    • Reactive oxygen species production

    • Callose deposition

    • Expression of defense marker genes

  • Compare transcriptional responses between wild-type and AT7 mutants using RNA-seq, focusing on:

    • Early response genes (induced within 1.5 hours of infection)

    • Defense signaling components

    • Metabolic pathway genes

  • Measure relevant physiological parameters:

    • Cellular redox state

    • Lipid composition changes

    • Salicylic acid and jasmonic acid levels

  • Integrate with existing knowledge of defense pathways:

    • NPR1-dependent responses

    • Salicylic acid-independent pathways

    • MAMP-triggered immunity

This approach parallels studies of NUDT7, which revealed its role as a negative regulator of basal defense, with the nudt7 mutation causing alterations in cellular redox status that primed cells for amplified defense responses .

How does AT7 function potentially relate to histone modifications and epigenetic regulation?

Recent research in Arabidopsis has revealed unexpected connections between epigenetic regulation and various cellular processes. For AT7:

  • Investigate potential H3K9me2 histone methylation at the AT7 locus, similar to what occurs at the RPP7 gene, where this mark influences alternative polyadenylation .

  • Examine whether transposable elements in AT7 introns might recruit H3K9me2 marks that affect transcript processing, as observed with COPIA-R7 in RPP7 intron1 .

  • Analyze whether stress conditions alter histone modifications at the AT7 locus, potentially shifting the balance between transcript isoforms.

  • Consider the role of EDM2-like PHD-finger proteins that might control H3K9me2 levels at AT7, affecting its expression through similar mechanisms as observed with RPP7 .

The RPP7 example demonstrates how "the histone mark H3K9me2, which is known to mediate transposon silencing, [can] determine the choice between alternative polyadenylation sites" , potentially representing a broader regulatory mechanism in Arabidopsis that might also affect AT7.

How can I effectively use Google's "People Also Ask" data to guide my AT7 research direction?

Google's People Also Ask (PAA) feature offers valuable insights for directing research on specialized topics like AT7:

  • Use PAA data to identify knowledge gaps and common questions in the field:

    • Appearing in over 80% of English searches, PAA reveals patterns in how researchers approach similar topics

    • Questions cascade to show related inquiries, helping map the conceptual landscape of AT7 research

  • Analyze question complexity to distinguish between established knowledge and research frontiers:

    • Basic questions often reflect well-understood aspects

    • Complex, specific questions may indicate active research areas

  • Track PAA changes over time to identify emerging research trends:

    • "Check back often to understand when to update your content"

    • New questions may signal shifts in research focus

  • Use PAA insights to structure your research publications for maximum impact:

    • Address common questions explicitly in your methodology sections

    • Position your findings in relation to frequently asked questions in the field

This approach leverages Google's aggregated search behavior data to understand "what your audience is looking to learn" , providing strategic direction for AT7 research efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.