Recombinant Arabidopsis thaliana Probable long-chain-alcohol O-fatty-acyltransferase 9 (At1g34500)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Gene Name: At1g34500
Synonyms: Wax Synthase 9, F12K21.19
UniProt ID: Q4PT07
Protein Length: 341 amino acids
Molecular Mass: 39.349 kDa
Catalytic Activity:

  • EC Number: 2.3.1.75

  • Reaction: Acyl-CoA + long-chain alcohol → CoA + long-chain ester

Key FeaturesDetails
FunctionCatalyzes the final step in wax ester biosynthesis
Substrate SpecificityPrefers C16/C18 acyl groups and C12–C20 alcohols
Cellular LocalizationPredominantly endoplasmic reticulum (ER)

Biochemical Role

  • Wax Ester Synthesis: Condenses fatty alcohols (e.g., C16–C20) with acyl-CoA substrates to form protective wax esters critical for plant cuticle formation .

  • Enzyme Kinetics: Demonstrated activity in yeast heterologous systems (Saccharomyces cerevisiae), confirming substrate flexibility .

Research Applications

  • Biotechnology: Engineered in Camelina sativa for industrial wax ester production .

  • Gene Family: Part of the WS/DGAT (wax synthase/diacylglycerol acyltransferase) family, sharing structural motifs with At5g37300 (WSD1) .

Comparative Analysis of Expression Systems

ParameterE. coliMammalian CellsBaculovirus
YieldHighModerateHigh
Post-Translational ModificationsLimitedExtensiveModerate
CostLowHighModerate
Use CaseStructural studiesFunctional assaysLarge-scale production

Source:

Key Research Findings

  1. Heterologous Expression in Yeast:

    • At1g34500 produced wax esters when co-expressed with fatty acyl-CoA reductases in S. cerevisiae .

    • Activity confirmed via thin-layer chromatography and mass spectrometry .

  2. Substrate Range:

    • Accepts diverse alcohols (primary, branched-chain, sterols) and acyl-CoA substrates (C12–C24) .

  3. Stability:

    • Lyophilized forms retain >85% activity after 12 months at -80°C .

Industrial Relevance

  • Bioengineering: Used to enhance drought tolerance in crops by modifying cuticular wax composition .

  • Sustainable Chemistry: Explored for biodegradable lubricant production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
At1g34500; F12K21.19; Probable long-chain-alcohol O-fatty-acyltransferase 9; Wax synthase 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g34500
Target Protein Sequence
MEEELKNFIIVWISAIISVSYCYYISANIKTGVLRLFSVLPICGLFFVLPLFFSSVHFSS STAFYLSEMASLKLILFAFDQGPLFPVAPNLIQFVCFTCFPIKLQRNPKSQPSQNHFHKR AFAIKIMIFGVVLHVYNYSHFLPQTVLLSLCFLHLYVELEILLGPLKVLLSMALGCDLEP QFNKPYLATSLQDFWGRRWNLMVSSVLRSGIYNPVRCACQRPMNSGWARFMGYLVTFLVS GLFHELVYFYITRETPTWEVTLFFVLNGVCTGTEVAVKRTAFLQRWWPVRSSVSRLLTMG FVVVTGGLLFFPLFIRSGMMERRANETLFFLDFVKRKFSIF
Uniprot No.

Target Background

Function
Catalyzes the final step in the synthesis of long-chain linear esters (waxes).
Database Links

KEGG: ath:AT1G34500

STRING: 3702.AT1G34500.1

UniGene: At.51936

Protein Families
Wax synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Arabidopsis thaliana Probable long-chain-alcohol O-fatty-acyltransferase 9 (At1g34500)?

At1g34500 encodes a probable long-chain-alcohol O-fatty-acyltransferase (EC 2.3.1.75), also known as Wax synthase 9, which belongs to a class of enzymes that catalyze the reaction between a fatty acyl alcohol and a fatty acyl-CoA to generate wax esters . This enzyme is part of the plant's surface wax biosynthesis pathway, which produces compounds crucial for protecting plants against water loss, pathogen attack, and environmental stresses. Specifically, wax esters contribute to drought tolerance in Arabidopsis by forming part of the cuticular barrier that restricts non-stomatal water loss . The protein likely functions in the biosynthetic pathway that produces the waxy cuticle covering aerial plant surfaces, acting as a hydrophobic barrier.

How is At1g34500 classified phylogenetically?

At1g34500 belongs to the MBOAT-like (Membrane-Bound O-Acyltransferase) wax synthase family. Phylogenetic analyses of wax ester producing enzymes classify plant wax synthases into distinct groups. While the search results don't specifically mention At1g34500's exact phylogenetic position, related Arabidopsis wax synthases have been classified through neighbor joining method phylogenetic analyses, with statistical rigor tested using bootstrap calculations (n = 1000) . These analyses typically use experimentally characterized WS sequences like jojoba WS (ScWS) and other Arabidopsis WS proteins (such as At5g55380) as references for classification . Understanding its phylogenetic position helps researchers predict functional properties and evolutionary relationships with other wax-producing enzymes.

What are the recommended storage conditions for recombinant At1g34500 protein?

The recombinant At1g34500 protein should be briefly centrifuged prior to opening to bring contents to the bottom. Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) and aliquoting for long-term storage . The default final concentration of glycerol is typically 50% . For optimal shelf life, the liquid form can be stored for approximately 6 months at -20°C/-80°C, while the lyophilized form maintains stability for approximately 12 months at the same temperature range . Repeated freezing and thawing is not recommended; working aliquots should be stored at 4°C for up to one week . Proper storage is critical for maintaining protein activity for experimental use.

How can researchers confirm successful expression of recombinant At1g34500?

Researchers can confirm successful expression of recombinant At1g34500 through immunological Western blot analysis. Based on methods used for similar wax synthase proteins, the recombinant protein can be designed with a His-tag to facilitate detection . Protein extracts should be subjected to SDS-PAGE separation followed by Western blotting using commercially available anti-His tag serum . This approach has been successfully employed for detecting expression of related Arabidopsis wax synthases like At5g55340 . Additionally, functional expression can be verified through activity assays, such as analyzing the production of wax esters in the expression system using thin-layer chromatography (TLC) and gas chromatography-mass spectrometry (GC-MS) of extracted lipids .

How can At1g34500 be functionally characterized through heterologous expression systems?

Functional characterization of At1g34500 can be achieved through heterologous expression in either yeast (Saccharomyces cerevisiae) or Arabidopsis seeds. For yeast expression, researchers should:

  • Construct expression vectors containing the At1g34500 coding sequence with a His-tag for detection

  • Transform into an appropriate yeast strain (similar to approaches used for related wax synthases)

  • Validate protein expression through Western blotting with anti-His antibodies

  • Assess enzymatic activity by supplying fatty alcohol and fatty acid precursors in the growth medium

  • Extract and analyze lipids using TLC and GC-MS to identify wax ester production

For expression in Arabidopsis seeds:

  • Create plant expression cassettes using seed-specific promoters (like the glycinin promoter)

  • Co-express with genes that produce fatty alcohol precursors (such as jojoba FAR)

  • Confirm transgene expression through RT-PCR using RNA isolated from developing siliques

  • Extract seed lipids and analyze wax ester production using GC-MS

These complementary approaches allow researchers to characterize the substrate preferences and catalytic activity of At1g34500 in different biological contexts.

What are the optimal substrates for At1g34500 and how can substrate specificity be determined?

The substrate specificity of At1g34500 can be determined through in vitro enzyme assays and in vivo expression studies. Based on methods used for related wax synthases, researchers should:

  • Express and purify the recombinant protein (>85% purity via SDS-PAGE)

  • Conduct in vitro assays using various combinations of fatty alcohols (varying in chain length from C16-C24 and saturation level) and fatty acyl-CoAs

  • Analyze reaction products using TLC and GC-MS

In heterologous expression systems, substrate specificity can be assessed by:

  • Growing transformed yeast in media supplemented with different fatty alcohols and fatty acids

  • Extracting lipids using chloroform-methanol extraction (as detailed for similar wax synthases):

    • Add 1 mL of methanol to yeast pellet and vortex for 1 min

    • Add 1 mL of chloroform and vortex for 3 min

    • Add 1 mL of H₂O and vortex for 5 min

    • Add another 500 μL of chloroform and vortex for 30 s

    • Add 500 μL of H₂O, vortex for 30 s

    • Separate phases by centrifugation at 5000× g for 4 min

    • Recover lower chloroform layer, filter through 0.45 μm PTFE filter, and evaporate

  • Analyze the produced wax esters to determine preferred substrate combinations

The results should be presented in a data table format similar to:

Substrate CombinationRelative Activity (%)Major Products Detected
C16:0-OH + C16:0-CoA[value][specific wax esters]
C18:1-OH + C16:0-CoA[value][specific wax esters]
C20:1-OH + C18:1-CoA[value][specific wax esters]
C22:1-OH + C18:0-CoA[value][specific wax esters]

How does the subcellular localization of At1g34500 influence its biological function?

The subcellular localization of At1g34500 can be determined using bioinformatic prediction tools and experimental approaches. Tools like TargetP can be employed to predict the probable subcellular location based on the protein sequence . For experimental confirmation, researchers should:

  • Create fusion constructs with fluorescent reporters (like GFP) at either N- or C-terminus, ensuring the tag doesn't interfere with targeting signals

  • Express these constructs in Arabidopsis or tobacco leaf cells

  • Analyze localization using fluorescence microscopy

  • Perform co-localization studies with organelle-specific markers

The localization pattern will provide insights into the protein's biological function. If localized to the endoplasmic reticulum (ER), it likely participates in the early steps of wax biosynthesis. Alternatively, localization to the plasma membrane or cell wall might suggest involvement in wax deposition or export mechanisms. Understanding subcellular localization is crucial for interpreting the protein's role in wax biosynthesis and its connection to other components of the pathway.

How does At1g34500 compare functionally to other wax synthases in Arabidopsis?

To compare At1g34500 functionally with other Arabidopsis wax synthases, researchers should conduct:

  • Sequence and structural comparisons:

    • Align protein sequences with other characterized wax synthases like WSD1 (which is required for stem wax ester biosynthesis)

    • Identify conserved catalytic domains and unique sequence features

  • Expression pattern analysis:

    • Conduct RT-PCR analysis across different tissues and developmental stages

    • Create promoter-reporter fusion constructs (like GUS) to visualize expression patterns histologically

    • Compare with expression data of other wax synthases to identify tissue-specific or overlapping expression

  • Functional complementation studies:

    • Express At1g34500 in Arabidopsis mutants lacking functional wax synthases

    • Evaluate restoration of wax production using GC-MS analysis

    • Compare complementation efficiency with other wax synthase genes

  • Co-expression network analysis:

    • Identify genes co-expressed with At1g34500 using transcriptomic data

    • Compare with co-expression networks of other MBOAT-like WS and WSD coding genes

    • Identify shared and unique network components that might indicate functional specialization

These comparative approaches will help determine whether At1g34500 has redundant functions with other wax synthases or possesses unique substrate preferences or tissue-specific roles in Arabidopsis development.

What experimental approaches can be used to investigate the role of At1g34500 in plant drought tolerance?

Given that surface wax esters contribute to drought tolerance in Arabidopsis , investigating At1g34500's role in this process requires:

  • Generation of knockout or knockdown lines:

    • Create T-DNA insertion mutants or RNAi constructs targeting At1g34500

    • Verify gene disruption via RT-PCR and protein expression analysis

    • Generate complementation lines expressing At1g34500 under native or constitutive promoters

  • Phenotypic characterization under drought conditions:

    • Subject wild-type, mutant, and complementation lines to controlled drought stress

    • Monitor physiological parameters:

      • Relative water content

      • Water loss rate from detached leaves

      • Stomatal conductance

      • Electrolyte leakage

      • Photosynthetic efficiency

  • Cuticular wax analysis:

    • Extract cuticular waxes using chloroform dipping method

    • Analyze wax composition via GC-MS

    • Quantify wax ester content and composition

    • Create a comparative table showing changes in wax composition:

Wax ComponentWild Type (μg/cm²)at1g34500 Mutant (μg/cm²)Complementation Line (μg/cm²)
Total wax esters[value][value][value]
Alkanes[value][value][value]
Primary alcohols[value][value][value]
Fatty acids[value][value][value]
  • Cuticle permeability assays:

    • Perform chlorophyll leaching assays

    • Conduct toluidine blue penetration tests

    • Measure cuticular transpiration rates

These approaches would provide comprehensive evidence for At1g34500's specific contribution to drought tolerance through its role in wax ester biosynthesis and cuticle formation.

What are the best approaches for optimizing recombinant At1g34500 expression and purification?

To optimize recombinant At1g34500 expression and purification, researchers should consider:

  • Expression system selection:

    • Mammalian cell systems have been successfully used for At1g34500 expression

    • Alternative systems like E. coli or insect cells may be tested for improved yield

    • Compare expression levels and functional activity across systems

  • Construct optimization:

    • Test different fusion tags (His, GST, MBP) for improved solubility and purification

    • Optimize codon usage for the selected expression system

    • Consider using truncated versions if certain domains affect expression

  • Expression conditions:

    • Vary induction parameters (temperature, inducer concentration, duration)

    • Test different media compositions

    • Optimize cell density at induction

  • Purification strategy:

    • Use affinity chromatography based on the fusion tag (e.g., Ni-NTA for His-tagged protein)

    • Add secondary purification steps (ion exchange, size exclusion) to achieve >85% purity

    • Optimize buffer conditions to maintain protein stability and activity

  • Protein stabilization:

    • Test different buffer compositions

    • Identify optimal pH range

    • Evaluate the effect of additives (glycerol, reducing agents, specific ions)

    • Determine appropriate storage conditions to maintain activity

Systematic optimization of these parameters will help achieve higher yields of functional protein for subsequent biochemical and structural studies.

How can researchers detect and quantify wax esters produced by At1g34500 in plant tissues?

Detection and quantification of wax esters produced by At1g34500 in plant tissues require:

  • Wax extraction:

    • For surface waxes: Dip plant tissues in chloroform for 30 seconds

    • For total lipids: Homogenize tissues and extract using chloroform:methanol (2:1, v/v)

    • Add internal standards (e.g., behenyl dodecanoate, C₃₄H₆₈O₂) for quantification

  • Initial analysis by TLC:

    • Use hexane:diethyl ether:acetic acid (90:10:1, v/v/v) as mobile phase

    • Visualize separated lipids by spraying with 0.05 mg/mL Primuline solution (in acetone/water, 80/20 v/v)

    • Observe under UV illumination

    • Compare with standards: wax ester (behenyl dodecanoate), fatty acid (palmitic acid), fatty alcohol (octadecanol)

  • Detailed analysis by GC-MS:

    • Scrape wax ester bands from TLC plates or use total lipid extract

    • Derivatize samples if necessary (e.g., silylation of hydroxyl groups)

    • Analyze using GC-MS with appropriate temperature program

    • Identify wax esters based on retention times and mass spectra

    • Quantify using calibration curves generated with authentic standards

  • Data analysis:

    • Calculate wax ester concentrations based on internal standards

    • Identify specific wax ester molecular species

    • Compare wax ester profiles between wild-type plants and those with altered At1g34500 expression

This analytical workflow enables comprehensive characterization of wax ester production attributable to At1g34500 activity in plant tissues.

What genetic engineering approaches can be used to modulate At1g34500 expression in plants?

Several genetic engineering approaches can be employed to modulate At1g34500 expression:

  • Overexpression strategies:

    • Create constructs with At1g34500 under control of constitutive promoters (35S CaMV) for whole-plant expression

    • Use tissue-specific promoters (e.g., glycinin promoter for seed-specific expression)

    • Employ inducible promoters for controlled expression timing

    • Generate constructs co-expressing At1g34500 with genes that produce precursors, such as fatty acyl reductases (FARs)

  • Gene knockdown/knockout approaches:

    • CRISPR/Cas9 gene editing to create null mutations

    • RNAi constructs targeting At1g34500 mRNA for degradation

    • Artificial microRNAs for specific gene silencing

    • T-DNA insertion mutant screening and characterization

  • Transformation methods:

    • Agrobacterium-mediated transformation for stable integration

    • Floral dip method for Arabidopsis transformation

    • Particle bombardment for recalcitrant species

  • Transgene validation:

    • RT-PCR to confirm expression changes, using specific primers that have been tested against wild-type Arabidopsis to ensure they don't generate false positive signals

    • Confirm transgene presence by genotyping PCR using DNA isolated from transformed plants

    • Sequence verification of PCR products to confirm identity

    • Western blot analysis to verify protein expression levels

  • Phenotypic evaluation:

    • Analyze changes in wax composition and content

    • Assess alterations in plant development and stress responses

    • Evaluate physiological parameters related to water relations and drought tolerance

These approaches provide a comprehensive toolkit for investigating At1g34500 function through genetic manipulation.

How can At1g34500 be used in synthetic biology approaches to engineer wax production?

At1g34500 can be leveraged in synthetic biology approaches to engineer wax production through:

  • Metabolic engineering of production hosts:

    • Express At1g34500 in microbial hosts (yeast, E. coli) or plant systems

    • Co-express with fatty acyl reductases to provide alcohol precursors

    • Engineer fatty acid biosynthesis pathways to increase precursor availability

    • Introduce genes for specific fatty acid or fatty alcohol production to tailor wax ester composition

  • Chimeric enzyme design:

    • Create fusion proteins combining At1g34500 with complementary enzymes

    • Engineer protein domains to alter substrate specificity

    • Employ protein engineering to enhance catalytic efficiency or stability

  • Multi-gene expression systems:

    • Design operons or polycistronic constructs for coordinated expression

    • Balance expression levels of pathway components

    • Co-express with transcription factors that upregulate lipid biosynthesis

  • Compartmentalization strategies:

    • Target enzymes to specific subcellular locations

    • Create synthetic organelles for wax biosynthesis

    • Use scaffolding proteins to increase local concentration of pathway enzymes

  • Evaluation methods:

    • Monitor wax ester production using TLC and GC-MS

    • Analyze wax ester composition profiles

    • Quantify production yields and rates

    • Assess economic feasibility of production systems

These approaches could lead to sustainable production of wax esters for various applications, including biofuels, cosmetics, and industrial lubricants, by harnessing the catalytic properties of At1g34500 in optimized production systems.

What insights can At1g34500 provide about the evolution of wax biosynthesis in land plants?

Studying At1g34500 can provide valuable insights into the evolution of wax biosynthesis in land plants:

  • Comparative genomic analysis:

    • Identify At1g34500 homologs across plant species, from early land plants to angiosperms

    • Construct phylogenetic trees to trace evolutionary relationships

    • Compare with the broader phylogeny of wax synthase and wax synthase/diacylglycerol acyltransferase (WSD) proteins

  • Functional conservation studies:

    • Express At1g34500 homologs from diverse plant species in heterologous systems

    • Compare substrate preferences and catalytic activities

    • Assess complementation ability in Arabidopsis mutants

  • Structural analysis:

    • Predict protein structures and compare catalytic domains

    • Identify conserved and divergent regions

    • Correlate structural features with functional specialization

  • Expression pattern comparison:

    • Analyze expression patterns of At1g34500 homologs across plant lineages

    • Correlate with environmental adaptations and habitat transitions

    • Identify regulatory elements that have evolved to control expression

  • Correlation with cuticular adaptations:

    • Connect enzyme evolution to changes in plant cuticle composition

    • Analyze how enzyme diversification contributed to terrestrial adaptation

    • Identify key evolutionary innovations in wax biosynthesis pathways

This evolutionary perspective would help understand how wax biosynthesis enzymes like At1g34500 contributed to plant adaptation to terrestrial environments through the development of protective surface waxes.

How can researchers develop effective experimental controls when working with At1g34500?

Developing robust experimental controls is crucial for research involving At1g34500:

  • Genetic controls:

    • Use wild-type plants as positive controls for native At1g34500 function

    • Include known At1g34500 knockout/knockdown lines as negative controls

    • Employ complementation lines expressing At1g34500 under native promoter

    • Use plants expressing related but functionally distinct wax synthases as specificity controls

  • Expression system controls:

    • For heterologous expression, include empty vector transformants

    • Use inactive enzyme variants (site-directed mutants of catalytic residues)

    • Include well-characterized related enzymes (e.g., At5g55340) as positive controls

  • RT-PCR controls:

    • Test primer specificity using wild-type RNA to ensure no false positive signals

    • Include no-RT controls to verify absence of genomic DNA contamination

    • Use constitutively expressed genes (e.g., Actin-2) as internal controls

  • Protein expression controls:

    • Verify protein expression through Western blotting with appropriate antibodies

    • Include purified recombinant protein as a positive control

    • Use unrelated proteins with similar tags as specificity controls

  • Wax analysis controls:

    • Include internal standards for wax extraction and quantification

    • Use authentic wax ester standards for TLC and GC-MS analysis

    • Compare with characterized wax mutants with known phenotypes

What are the key knowledge gaps in our understanding of At1g34500 function?

Despite advances in characterizing wax synthases in Arabidopsis, several knowledge gaps remain regarding At1g34500:

  • Precise biological role:

    • Tissue-specific functions remain incompletely characterized

    • Contribution to specific wax ester pools in different plant organs

    • Potential overlapping functions with other wax synthases

    • Role in developmental processes beyond cuticle formation

  • Regulatory mechanisms:

    • Transcriptional and post-transcriptional regulation

    • Potential post-translational modifications affecting activity

    • Response to environmental stresses and developmental cues

    • Protein-protein interactions with other lipid biosynthesis enzymes

  • Structural aspects:

    • Three-dimensional structure remains unsolved

    • Structural basis for substrate recognition and catalysis

    • Membrane topology and integration mechanism

    • Structure-function relationships for catalytic activity

  • Evolutionary significance:

    • Selective pressures driving At1g34500 evolution

    • Functional divergence from ancestral enzymes

    • Contribution to plant adaptation to diverse environments

Addressing these knowledge gaps will provide a more comprehensive understanding of At1g34500's role in plant biology and could inform applications in crop improvement for enhanced stress tolerance.

How can systems biology approaches advance our understanding of At1g34500 in plant metabolism?

Systems biology approaches offer powerful tools for understanding At1g34500's role in plant metabolism:

These systems-level approaches would provide a holistic understanding of At1g34500's role within the broader context of plant metabolism and stress responses, revealing emergent properties not apparent from reductionist approaches.

What are the essential resources for researchers studying At1g34500?

Researchers studying At1g34500 should utilize these essential resources:

  • Biological materials:

    • Recombinant protein (available commercially, e.g., product code CSB-MP689853DOA1)

    • T-DNA insertion lines targeting At1g34500

    • Arabidopsis ecotypes for natural variation studies

    • Expression constructs for heterologous expression

  • Online databases:

    • UniProt (Q4PT07) for protein sequence and annotation

    • TAIR (The Arabidopsis Information Resource) for gene information

    • Arabidopsis eFP Browser for expression data visualization

    • Phytozome for comparative genomics

    • BRENDA for enzyme property data

  • Experimental protocols:

    • Protein expression and purification methods

    • Lipid extraction and analysis techniques

    • Heterologous expression in yeast and plants

    • RT-PCR and Western blot protocols

  • Analytical standards:

    • Wax ester standards (e.g., behenyl dodecanoate, C₃₄H₆₈O₂)

    • Fatty alcohol standards (e.g., octadecanol)

    • Fatty acid standards (e.g., palmitic acid)

  • Bioinformatic tools:

    • TargetP for subcellular localization prediction

    • Phylogenetic analysis software for evolutionary studies

    • Protein structure prediction algorithms

    • Sequence alignment tools for comparative analysis

These resources provide the foundation for comprehensive investigation of At1g34500 structure, function, and biological significance in plant metabolism and development.

How can researchers troubleshoot common problems when working with At1g34500?

Researchers may encounter several challenges when working with At1g34500. Here are troubleshooting approaches for common issues:

  • Low protein expression:

    • Optimize codon usage for expression system

    • Test different expression vectors and promoters

    • Adjust induction conditions (temperature, concentration, timing)

    • Consider fusion partners that enhance solubility (e.g., MBP, SUMO)

    • Screen multiple colonies/clones for higher expression

  • Protein inactivity:

    • Ensure proper protein folding with appropriate buffer conditions

    • Add glycerol (5-50%) to stabilize the protein

    • Verify integrity of catalytic domains through sequencing

    • Test for inhibitory compounds in the assay

    • Ensure availability of correct substrates

  • Difficulties in lipid analysis:

    • Include internal standards for extraction efficiency control

    • Use fresh solvents and maintain anhydrous conditions

    • Optimize extraction protocol for specific tissue types

    • Ensure proper separation on TLC by optimizing mobile phase

    • Calibrate GC-MS regularly with authentic standards

  • Unsuccessful genetic manipulation:

    • Verify transgene integration through PCR and sequencing

    • Confirm transcript levels through RT-PCR

    • Test multiple independent transformation lines

    • Consider silencing effects in high-copy transformants

    • Evaluate potential lethality of genetic modifications

  • Inconsistent phenotypes:

    • Control environmental conditions rigorously

    • Use sufficient biological and technical replicates

    • Minimize batch effects through experimental design

    • Consider genetic background effects

    • Account for developmental stage variability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.