Recombinant Arabidopsis thaliana Probable mannan synthase 10 (CSLA10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us and we will prioritize developing the specified tag.
Synonyms
CSLA10; At1g24070; T23E23.23; Probable glucomannan 4-beta-mannosyltransferase 10; Cellulose synthase-like protein A10; AtCslA10; Glucomannan synthase; Mannan synthase 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLA10
Target Protein Sequence
MTTFLKSLIFLQDSCLAFLSLMFHRGSSEDAAEALKKLETSINGARISFDTTWTREFRSL FIVPLFKCLVAFCLIISLLVFIEGIYMNLVVLYVKVFERKPEKVYRWEAMQEDIELGHET YPMVLVQIPMYNEKEVLQLSIGAACRLIWPLDRLIVQVLDDSTDQTIKELVNTECAKWES KGVNIKCERRDNRNGYKAGALKEGMKHNYVKLCNYVVIFDADFQPEPDYLQHSVPFLVHN PEVALVQARWRFMNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFSFNGTAGVWRMAAM EEAGGWHDRTTVEDMDLAVRAGLLGWKFVFLNDLTVKSELPSKFKAFRFQQHRWSCGPAN LFRKMIMEIIRNKRVTIWKKLYLVYSFFFLRKIIVHCFTFIFYCVILPTSVFFPEVNIPA WSTFYIPSMITLCIVIATPRSFYLVIFWILFENVMSMHRTKGTFIGILERQRVNEWVVTE KLGDALKTKLLPRIGKPSNMFLERVNSKEIMVGIYILCCACYGLFFGNTLLYLYLFMQAV AFLISGVGFVGT
Uniprot No.

Target Background

Function
This protein is a probable mannan synthase with 4-beta-mannosyltransferase activity on mannan, utilizing GDP-mannose as a substrate. The resulting beta-1,4-mannan product serves as the backbone for galactomannan synthesis catalyzed by galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide found in plant cell walls.
Database Links

KEGG: ath:AT1G24070

STRING: 3702.AT1G24070.1

UniGene: At.41488

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA10 and what is its role in plant cell wall biosynthesis?

CSLA10 (Cellulose Synthase-Like A10) is a membrane-bound glycosyltransferase in Arabidopsis thaliana that belongs to the CSLA family of proteins. Like other CSLA proteins, it is predicted to function as a β-1,4-mannosyltransferase involved in the synthesis of mannan polysaccharides in plant cell walls. The protein contains multiple transmembrane domains and is classified as a probable glucomannan 4-beta-mannosyltransferase.

CSLA10 (gene At1g24070) encodes a 552-amino acid protein and represents one member of the broader CSLA family that has been implicated in mannan and glucomannan synthesis. CSLA proteins are characterized by their ability to transfer mannose residues from GDP-mannose to form the β-1,4-linked backbone of mannans or glucomannans, which are important structural components of plant cell walls .

How does CSLA10 structurally compare to other mannan synthases?

CSLA10 shares significant structural similarities with other CSLA family members, containing multiple transmembrane domains that anchor the protein to the endomembrane system. The protein exhibits the characteristic GT2 family glycosyltransferase fold with a catalytic domain that processes nucleotide-sugar donors.

The full-length protein (552 amino acids) contains conserved domains that are typical of processive glycosyltransferases, including predicted binding sites for GDP-mannose. The catalytic core regions of CSLA10 show homology to other mannan synthases, though specific amino acid variations likely contribute to differences in substrate specificity or catalytic efficiency compared to other CSLA isoforms .

What are the differences between mannans and glucomannans synthesized by CSLA enzymes?

Mannans and glucomannans represent distinct polysaccharide types in plant cell walls that differ in their sugar composition:

  • Mannans are homopolymers consisting of a backbone of β-1,4-linked mannose residues only.

  • Glucomannans are heteropolymers with a backbone containing both β-1,4-linked mannose and glucose residues in varying ratios.

Research has shown that CSLA proteins can synthesize either mannans or glucomannans depending on the specific CSLA isoform and the presence of cofactors. For example, AtCSLA2 alone produces mannan, but when co-expressed with AtMSR1 (a cofactor protein), it synthesizes glucomannan with a glucose to mannose ratio of approximately 1:3.2 to 1:4.5 . The factors determining whether a CSLA enzyme produces pure mannan versus glucomannan include:

  • The specific CSLA isoform involved

  • The presence of accessory proteins like MSR family members

  • The availability of nucleotide sugar donors (GDP-mannose and GDP-glucose)

  • The developmental stage and tissue type

These structural differences between mannans and glucomannans impact their physical properties and functions in the cell wall .

What expression systems are optimal for producing functional recombinant CSLA10?

Several expression systems have been employed for producing functional recombinant CSLA proteins, each with distinct advantages:

Bacterial Expression (E. coli):

  • Commonly used for producing N-terminal His-tagged CSLA10 protein

  • Advantages include high yields and simplified purification

  • Challenges include proper folding of membrane proteins and lack of post-translational modifications

  • Most suitable for structural studies or antibody production

Yeast Expression (Pichia pastoris):

  • Demonstrated success for functional expression of CSLA proteins

  • Provides eukaryotic processing environment with minimal endogenous mannan

  • Can produce large amounts of heterologous plant hemicelluloses when CSLA genes are expressed

  • Enables in vivo activity studies without extensive purification

  • Pichia contains only trace amounts of 4-linked mannose in its wall, minimizing background interference

Plant-based Expression Systems:

  • Tobacco has been successfully used for transient expression of CSLA proteins

  • Provides a more native environment for proper folding and activity

  • Microsomes isolated from transformed tobacco plants show high mannan synthase activity

  • Allows for protein-protein interaction studies in a plant cellular context

For functional studies of CSLA10, Pichia pastoris represents a particularly valuable system as it allows for both in vivo synthesis of mannans and preparation of microsomes for in vitro assays.

How can researchers verify the enzymatic activity of recombinant CSLA10?

Verification of CSLA10 enzymatic activity requires multiple complementary approaches:

In Vitro Enzymatic Assays:

  • Microsome preparation: Isolate membrane fractions containing the recombinant protein

  • Nucleotide sugar incorporation: Measure incorporation of radiolabeled [14C]-GDP-mannose or GDP-glucose into alcohol-insoluble products

  • Product analysis: Characterize the synthesized polysaccharides through:

    • Glycosidic linkage analysis using methylation and GC-MS

    • 1H-NMR spectroscopy to determine mannose/glucose ratios

    • Size-exclusion chromatography to determine polymer size distribution

In Vivo Analysis in Heterologous Systems:

  • Cell wall polysaccharide extraction (using AIR - Alcohol Insoluble Residue method)

  • Enzymatic or chemical digestion of polysaccharides

  • HPAEC-PAD (High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection) analysis of released oligosaccharides

  • Immunodetection using mannan-specific antibodies (e.g., LM21 for pure mannans or antibodies specific for glucomannans)

Complementation Studies:

  • Expression of CSLA10 in csla mutant backgrounds

  • Analysis of phenotypic rescue

  • Quantification of restored mannan content

The combination of these approaches provides comprehensive verification of CSLA10 activity and insights into its specific product profile.

What challenges exist in studying CSLA activity in planta versus heterologous systems?

Studying CSLA proteins presents several significant challenges that differ between in planta and heterologous systems:

Challenges in Planta:

  • Genetic Redundancy: Multiple CSLA genes with overlapping functions complicate single-gene mutant analysis

  • Embryo Lethality: Some CSLA mutants (e.g., csla7) are embryo-lethal, preventing comprehensive functional analysis

  • Pleiotropic Effects: Disruption of cell wall synthesis can lead to complex developmental phenotypes that obscure direct enzyme functions

  • Endogenous Enzyme Activity: Background activity from native glycosyltransferases can interfere with specific activity measurements

  • Low Protein Abundance: CSLA proteins are typically expressed at very low levels in native tissues

Advantages of Heterologous Systems:

  • Minimal Background: Systems like Pichia have minimal endogenous mannan, providing clearer results

  • High Expression: Can achieve higher protein levels than naturally occur in plants

  • Controlled Environment: More precise control over experimental conditions

  • System Simplicity: Reduced complexity compared to plant systems

  • Scalability: Easier to scale up for biochemical and structural analyses

Technical Difficulties Common to Both:

  • Membrane Protein Challenges: CSLA proteins have transmembrane domains, making purification in active form difficult

  • Co-factor Requirements: May require accessory proteins (like MSR) for full activity

  • In vitro Yield Limitations: Traditional in vitro assays with microsomes produce limited yields

Heterologous expression in Pichia has emerged as a particularly valuable approach as it successfully addresses many of these challenges, allowing researchers to produce sufficient quantities of plant hemicelluloses for detailed structural characterization without relying on radioactive nucleotide sugars .

How do MSR proteins modify the activity of CSLA enzymes?

MSR (MANNAN SYNTHESIS RELATED) proteins function as critical cofactors that modify CSLA enzyme activity in several important ways:

Product Composition Modulation:

  • AtMSR1 enables AtCSLA2 to produce glucomannan instead of pure mannan

  • Without AtMSR1, AtCSLA2 produces only mannan polymer

  • With AtMSR1, AtCSLA2 incorporates both glucose and mannose in a ratio of approximately 1:3.2 to 1:4.5

Differential Effects on Various CSLA Isoforms:

  • The effect of MSR proteins is CSLA-isoform specific

  • While AtMSR1 enhances glucomannan production with AtCSLA2, it has an inhibitory effect when co-expressed with AtCSLA7

  • AtCSLA7 + AtMSR1 shows decreased 4-linked mannose production compared to AtCSLA7 alone

Mechanism of Action:

  • MSR proteins share sequence homology with mammalian PoFUT1 enzymes, which decorate proteins with O-glycan groups

  • Mutagenesis of conserved amino acids in AtMSR1 that are involved in nucleotide sugar binding significantly reduces both glucose and mannose incorporation

  • The membrane-anchoring domain of AtMSR1 is critical, as demonstrated by reduced activity in the AtMSR1 Δ28 mutant strain

  • Current hypothesis suggests MSR proteins may affect CSLA activity through protein glycosylation, though direct physical interactions may also play a role

This complex interplay between specific CSLA enzymes and MSR cofactors enables the plant to fine-tune the composition of cell wall mannans during development and in different tissues.

What structural domains of CSLA10 are critical for mannan synthase activity?

While the search results don't provide specific information about CSLA10's critical domains, insights from related CSLA proteins can inform our understanding:

Predicted Critical Domains in CSLA Proteins:

  • Transmembrane Domains:

    • Multiple transmembrane spans anchor the protein in the Golgi/ER membrane

    • Proper membrane integration is essential for activity

    • The topology places the catalytic domain toward the Golgi lumen where polysaccharide synthesis occurs

  • Catalytic Domain:

    • Contains the GT2 family glycosyltransferase fold

    • Includes conserved DXD motifs for coordination of divalent cations (typically Mn²⁺)

    • Features nucleotide-sugar binding sites for GDP-mannose/GDP-glucose

  • Acceptor Binding Site:

    • Binds the growing polysaccharide chain

    • Contains residues that determine specificity for mannose versus glucose incorporation

  • Protein-Protein Interaction Interfaces:

    • Regions that interact with cofactors like MSR proteins

    • Potentially involved in forming homodimers or heterodimers with other CSLA enzymes

Future structure-function studies through site-directed mutagenesis and protein truncation experiments would be valuable for definitively identifying the critical domains in CSLA10. The importance of these structural elements can be inferred from experiments with related CSLA proteins, which demonstrate that even subtle mutations can significantly impact activity and product profiles .

What evidence exists for CSLA protein complexes in mannan biosynthesis?

The search results provide several lines of evidence supporting the formation of protein complexes during mannan biosynthesis:

Evidence for CSLA-MSR Protein Complexes:

  • AtCSLA2 requires AtMSR1 as a cofactor to produce glucomannan instead of mannan

  • Mutations in the conserved sugar-binding motif of AtMSR1 are detrimental to AtCSLA2 activity

  • The hypothesis that "plant MSR proteins may affect CSLA activity via protein glycosylation" suggests a close physical interaction

Evidence for CSLA-CSLA Interactions:

  • The slight reduction of (gluco)mannan antibody binding in csla2/csla3 stems suggests cooperative activity between these two CSLA proteins

Evidence from Other Cell Wall Biosynthetic Complexes:

  • The CSLD family provides a precedent for glycosyltransferase interactions, with CSLD2 and CSLD3 only showing mannan synthase activity when co-expressed

  • CSLD2 and CSLD3 are strongly co-expressed in Arabidopsis thaliana, suggesting coordinated function

  • The severe phenotypes of csld2/csld5 and csld3/csld5 double mutants indicate non-redundant but potentially interactive functions

Broader Evidence from Other Non-Cellulosic Glycosyltransferase Complexes:

  • Direct evidence exists for glucuronoarabinoxylan synthase complexes in wheat (TaGT43-4, TaGT47-13, and TaGT75-4)

  • Dimerization between ARAD1 and ARAD2 involved in arabinan biosynthesis has been confirmed

  • Indirect evidence suggests GAUT1/GAUT7 probably form a homogalacturonan synthase complex

While direct physical evidence for CSLA10 participation in protein complexes is not provided in the search results, the considerable evidence for complex formation in related glycosyltransferases and other CSLA proteins strongly suggests that CSLA10 likely functions within similar multi-protein assemblies.

How does CSLA10 function compare to CSLD proteins in mannan synthesis?

CSLA and CSLD proteins both demonstrate mannan synthase activity but exhibit important differences in their expression patterns, product profiles, and biological roles:

Functional Comparison:

FeatureCSLA FamilyCSLD Family
Primary productGlucomannans and mannansPure mannans
Expression timingActive in mature tissuesFunction at earlier developmental stages
Cell-specific expressionBroad tissue distributionActive in specific structures (e.g., root hair tips)
Abundance of productBulk glucomannan productionLess abundant pure mannan synthesis
Antibody detectionDetected by antibodies with preference for glucomannansDetected by LM21 antibody which preferentially binds unsubstituted pure mannans
Mutant phenotypesVariable effects on mature plant structuresSevere developmental phenotypes in early growth

Evolutionary Relationship:

  • CSLD proteins are more closely related to cellulose synthases (CESAs) than the CSLA family

  • This relationship is surprising given that other CSL families more distant from CESAs (CSLC, CSLF, CSLH) have been shown to have β-1,4-glucan synthase activity rather than mannan synthase activity

Cooperative Activity:

  • While CSLA proteins can function individually or with MSR cofactors, some CSLD proteins (CSLD2 and CSLD3) only show mannan synthase activity when co-expressed

  • This suggests a more obligate requirement for protein-protein interactions in the CSLD family

The distinct but complementary roles of these two protein families suggest they produce different mannan types at different developmental stages, potentially fulfilling separate structural or signaling functions in plant development .

What are the key differences in mannan production between different CSLA enzymes?

CSLA enzymes exhibit significant diversity in their product profiles, activity levels, and responses to cofactors:

Product Composition Differences:

CSLA EnzymePrimary Product Without CofactorsProduct With MSR CofactorsGlucose:Mannose Ratio
AtCSLA2MannanGlucomannan1:3.2-4.5
AtCSLA7Mannan onlyDecreased mannan productionN/A
AkCSLA3Not explicitly statedNot explicitly statedNot provided

Phylogenetic Relationships:

  • AtCSLA2 and AtCSLA7 belong to distinct phylogenetic clades within the CSLA family

  • AtCSLA7 only elongates mannan in vitro and does not incorporate glucose even with cofactors

  • These differences suggest structural variations in the catalytic domains determining nucleotide-sugar specificity

Biological Context:

  • Different CSLA enzymes show tissue-specific expression patterns

  • Some (like AtCSLA7) are essential for embryo development, while others play roles in specific cell types or developmental stages

  • csla7 mutants are embryo-lethal, indicating a non-redundant essential function

These differences highlight the specialized roles of individual CSLA enzymes in producing mannans with specific compositions tailored to different developmental contexts and cellular requirements.

What methods are most effective for distinguishing between different mannan types in experimental samples?

Distinguishing between different mannan types requires a combination of complementary analytical techniques:

Immunological Methods:

  • Antibody Selection: Different antibodies have distinct specificities

    • Polyclonal anti-mannan antibodies typically show higher affinity for glucomannans

    • LM21 antibody preferentially detects unsubstituted pure mannans with lower affinity for glucomannans

  • Immunohistochemistry: Allows visualization of mannan distribution in tissue sections

  • ELISA: Enables quantitative comparison of different mannan epitopes

Spectroscopic Techniques:

  • 1H-NMR Spectroscopy: Provides definitive evidence for the presence of both β-1,4-glucosyl and β-1,4-mannosyl residues in glucomannans

    • Can determine precise glucose-to-mannose ratios (e.g., 1:3.2 ratio in AtCSLA2+AtMSR1 products)

  • 13C-NMR: Offers additional structural details about linkage types

Chromatographic and Mass Spectrometry Methods:

  • Glycosidic Linkage Analysis: Methylation followed by GC-MS analysis

    • Quantifies 4-linked mannose vs. 4-linked glucose content

    • Can detect subtle changes in polymer composition

  • Size-exclusion Chromatography: Determines molecular weight distribution of mannan polymers

    • Confirms that glucose and mannose residues are part of the same polymer

    • Provides information about polymer heterodispersity (e.g., ranging from <5 kDa to >270 kDa)

  • HPAEC-PAD: Analyzes oligosaccharides released by enzymatic digestion

Enzymatic Fingerprinting:

  • Specific mannanases release characteristic oligosaccharides from different mannan types

  • Pattern of released fragments distinguishes pure mannans from glucomannans

  • Can detect even minor mannan components that might be missed by bulk analysis

The most effective approach combines multiple methods - typically starting with immunological screening, followed by detailed compositional analysis using NMR and linkage analysis, and finally enzymatic fingerprinting to confirm structural features.

What are the common challenges in expressing and purifying active CSLA10 protein?

Researchers face several significant challenges when working with CSLA10 and other mannan synthases:

Expression Challenges:

  • Membrane Protein Solubility: CSLA10 contains multiple transmembrane domains, making it inherently difficult to solubilize while maintaining activity

  • Proper Folding: Ensuring correct protein folding in heterologous systems, particularly in bacterial expression

  • Low Expression Levels: Glycosyltransferases involved in cell wall synthesis typically express at very low levels

  • Toxicity: Overexpression can sometimes be toxic to host cells

Purification Challenges:

  • Maintaining Activity: GTs required for cell wall biosynthesis are "difficult to purify in active form"

  • Detergent Selection: Finding detergents that solubilize the protein without denaturing it

  • Co-factor Requirements: Potential loss of essential co-factors during purification

  • Stability Issues: Membrane proteins often have limited stability once removed from the membrane environment

Methodological Solutions:

  • Expression System Selection:

    • E. coli: Suitable for structural studies but may lack activity (His-tagged protein)

    • Pichia pastoris: Better for functional studies as it can properly fold and process the protein

  • Microsome Preparation: Rather than purifying the protein, isolating microsomes containing the recombinant protein often preserves activity

  • In vivo Assays: Using the Pichia system to produce hemicelluloses in vivo circumvents many purification challenges

  • Optimal Storage Conditions:

    • Lyophilized powder format

    • Store at -20°C/-80°C with aliquoting to prevent freeze-thaw cycles

    • Use of stabilizing agents (e.g., 6% Trehalose in storage buffer)

  • Reconstitution Protocol:

    • Centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for long-term storage

These challenges explain why many studies utilize microsomal fractions or whole-cell systems rather than purified enzymes for activity assays with CSLA proteins.

How can researchers optimize in vitro mannan synthase activity assays?

Optimizing in vitro mannan synthase activity assays requires careful attention to multiple experimental parameters:

Essential Components for Optimal Activity:

ComponentOptimal ConditionNotes
Membrane FractionFreshly prepared microsomesMaintain at 4°C until use
Metal CofactorMn²⁺ (typically 10-20 mM)Required for coordination of GDP-mannose
pH7.0-7.5Buffer typically Tris/PBS-based
Nucleotide SugarsGDP-mannose, GDP-glucoseFresh or with minimal freeze-thaw cycles
AcceptorsEndogenous or exogenous mannooligosaccharidesMay enhance activity
Protein PartnersMSR proteins for some CSLA enzymesCritical for glucomannan synthesis

Methodological Considerations:

  • Microsome Preparation:

    • Gentle homogenization to preserve membrane integrity

    • Differential centrifugation to isolate specific membrane fractions

    • Protein concentration determination for normalization

  • Reaction Conditions:

    • Temperature optimization (typically 25-30°C)

    • Protection from proteases (inhibitor cocktail)

    • Incubation time optimization (typically 30-60 minutes)

  • Product Detection Strategies:

    • Traditional radioactive assays using [¹⁴C]-labeled nucleotide sugars

    • Non-radioactive alternatives:

      • Analysis of alcohol-insoluble products by linkage analysis

      • Antibody-based detection of synthesized mannans

      • Fluorescently labeled acceptors to track extension

  • Controls and Validations:

    • Heat-inactivated enzyme controls

    • Omission of essential components (GDP-sugars, Mn²⁺)

    • Competition assays with unlabeled nucleotide sugars

    • Enzymatic digestion to confirm product identity

What genetic approaches are most effective for studying CSLA10 function in planta?

Several genetic approaches have proven valuable for investigating CSLA function in plants, with specific considerations for CSLA10:

Loss-of-Function Approaches:

  • T-DNA Insertion Lines:

    • Widely used for generating knockout mutants in Arabidopsis

    • Screening considerations:

      • Confirm insertion location and homozygosity

      • Verify absence of target transcript by RT-PCR

      • Test for truncated proteins by Western blot

  • CRISPR/Cas9 Gene Editing:

    • Enables precise targeting of CSLA10

    • Advantages:

      • Can generate complete knockouts or specific domain deletions

      • Possible to create multiple mutations simultaneously

      • Reduced risk of off-target effects compared to RNAi

  • Higher-Order Mutants:

    • Creating double and triple mutants reveals functional redundancy

    • Examples from search results:

      • csld2/csld3, csld2/csld5, csld3/csld5 double mutants

      • csld2/csld3/csld5 triple mutant

    • These approaches revealed that "CSLD2, CSLD3 and CSLD5 are involved in mannan synthesis and that their products are necessary for the transition between early developmental stages in Arabidopsis"

Gain-of-Function Approaches:

  • Overexpression Studies:

    • Promoter options:

      • Constitutive (35S, UBQ10)

      • Tissue-specific promoters for targeted expression

      • Inducible systems (e.g., estradiol-inducible)

    • Can reveal dose-dependent effects on mannan synthesis

  • Complementation Assays:

    • Expression of CSLA10 in csla mutant backgrounds

    • Evaluating rescue of phenotypes and cell wall composition

    • Search results indicate successful complementation studies with CSLD proteins

  • Fluorescent Protein Fusions:

    • C- or N-terminal GFP/YFP fusions to study localization

    • FRET or BiFC to investigate protein-protein interactions

    • Caution needed to ensure fusion proteins retain activity

Analytical Methods for Phenotyping:

  • Cell Wall Composition Analysis:

    • Immunohistochemistry with mannan-specific antibodies

    • Linkage analysis to quantify 4-linked mannose content

    • Enzymatic fingerprinting to identify specific mannan structures

  • Developmental Phenotyping:

    • Microscopic analysis of cell morphology

    • Growth and development measurements

    • Specific assays for cell types known to be rich in mannans

The search results emphasize the value of multiple mutant combinations in revealing non-redundant but potentially interactive functions between related proteins, an approach likely to be productive for CSLA10 studies as well .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.