Recombinant Arabidopsis thaliana Probable mannan synthase 11 (CSLA11)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

CSLA11 exhibits mannan synthase activity, catalyzing the transfer of mannose from GDP-mannose to form β-1,4-mannan backbones. Key enzymatic features include:

  • Substrate Specificity: Utilizes GDP-mannose and GDP-glucose to synthesize glucomannan heteropolymers .

  • Catalytic Efficiency: Demonstrated in vitro using recombinant proteins expressed in insect cells, with activity dependent on Mn²⁺ or Mg²⁺ cofactors .

  • Product Structure: Generates linear mannans or glucomannans with random glucose substitutions .

Table 1: Enzymatic Activity of Recombinant CSLA11

ParameterObservationSource
Preferred SubstrateGDP-mannose
Secondary SubstrateGDP-glucose (for glucomannan synthesis)
Metal Ion RequirementMn²⁺ > Mg²⁺
pH Optimum7.0–8.0

Functional Role in Plant Cell Walls

CSLA11 belongs to the Cellulose Synthase-Like A (CSLA) family, which specializes in synthesizing hemicellulosic polysaccharides. Its functions include:

  • Mannan Biosynthesis: Produces glucomannan, a major component of secondary cell walls in Arabidopsis stems .

  • Developmental Regulation: Critical for root hair elongation and seed mucilage formation, as shown in csla2/csla3/csla9 triple mutants lacking glucomannan .

  • Evolutionary Conservation: CSLA homologs in green algae and land plants suggest an ancient role in mannan synthesis .

Heterologous Expression Studies

  • Expression of CSLA11 in Drosophila S2 cells confirmed its ability to synthesize β-mannan and glucomannan de novo .

  • Tobacco microsomes expressing Arabidopsis CSLA11 showed elevated mannan synthase activity, confirming functional redundancy among CSLA family members .

Mutant Phenotypes

  • csla11 mutants exhibit no gross morphological defects, suggesting functional redundancy with other CSLA isoforms .

  • Triple mutants (csla2/csla3/csla9) display a 90% reduction in stem glucomannan, highlighting CSLA’s dominant role over CSLD isoforms in bulk mannan synthesis .

Applications and Technical Considerations

  • Research Use: CSLA11 is widely used to study mannan biosynthesis mechanisms and engineer plant cell walls for biofuel production .

  • Storage Stability: Lyophilized protein retains activity for >6 months at -80°C but degrades after 3–4 freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CSLA11; At5g16190; T21H19.110; Probable glucomannan 4-beta-mannosyltransferase 11; Cellulose synthase-like protein A11; AtCslA11; Glucomannan synthase; Mannan synthase 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLA11
Target Protein Sequence
MQEDLELGNQNFPMVLVQIPMYNEREVFKLSIGAACRLIWPLDRLIVQVLDDSTDPTIME MVSTECGKWATKGINIKCERRDNRNGYKAGALKQGMRHSYVKTCTYIAIFDADFQPEPDY LERTVPFLIHNPELALVQARWKFVNAKKCLMTRMQEMSLNYHFTAEQESGSTRHAFFGFN GTAGVWRLAAMEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDVSVKSELPSQFKAFRF QQHRWSCGPANLFRKMTMEIIRNKRVTIWKKLYVIYSFFFVRKIIVHFFTFFFYCFILPT SVFFPEVNIPTWSTVYFPFMITLFNAIATPRSFYLVIFWVLFENVMAMHRTKGTFIGLLE GGRVNEWVVTEKLGDALETKLLPQVRKPRNGFLERINSKEMMVGIYILCCASYNLVFGKT VLYIYLYMQALAFIIAGIGFIGT
Uniprot No.

Target Background

Function

Probable mannan synthase with 4-beta-mannosyltransferase activity on mannan using GDP-mannose as a substrate. This enzyme synthesizes the beta-1,4-mannan backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide component of plant cell walls.

Database Links

KEGG: ath:AT5G16190

STRING: 3702.AT5G16190.1

UniGene: At.31704

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA11 and what is its role in Arabidopsis thaliana?

CSLA11 (Probable mannan synthase 11) is a member of the Cellulose Synthase-Like A (CSLA) family of glycosyltransferases in Arabidopsis thaliana. This protein is encoded by the CSLA11 gene (At5g16190) and functions as a glucomannan 4-beta-mannosyltransferase . The CSLA family has been demonstrated to synthesize mannan polysaccharides in plant cell walls, particularly glucomannans, which are hemicellulosic polysaccharides that contribute to cell wall structure .

Unlike some other CSLA proteins (such as CSLA7), CSLA11 has not been directly implicated as essential for embryogenesis, but it is part of the broader CSLA family that synthesizes mannans which have been implicated as structural constituents of cell walls and potentially involved in other developmental processes . To study CSLA11 function, researchers typically use genetic approaches including characterization of insertion mutants, overexpression studies, and complementation tests similar to those used for other CSLA genes .

How does recombinant CSLA11 protein differ from the native form?

Recombinant CSLA11 protein, such as the commercially available His-tagged version (1-443 amino acids), is produced in heterologous expression systems like E. coli . This differs from the native form in several important ways:

  • Protein modifications: The recombinant form typically contains affinity tags (like the His-tag) that are not present in the native protein, facilitating purification but potentially affecting protein folding or function .

  • Post-translational modifications: When expressed in E. coli, the protein lacks plant-specific post-translational modifications that might be present in the native form, particularly glycosylation patterns that could affect enzyme activity .

  • Protein folding environment: The reducing environment of E. coli cytoplasm differs from the plant cell environment, potentially affecting disulfide bond formation and protein folding .

To address these limitations, researchers working with CSLA proteins have developed improved Arabidopsis-based super-expression systems that allow for homologous protein production with proper post-translational modifications . This approach can yield up to 0.4 mg of purified protein per gram fresh weight, providing sufficient material for biochemical and structural studies while maintaining native-like processing .

What are the optimal storage conditions for recombinant CSLA11?

For recombinant CSLA11 protein, proper storage is crucial to maintain enzyme activity. According to product specifications, the following storage protocol is recommended:

  • Long-term storage: Store the lyophilized powder at -20°C/-80°C upon receipt .

  • Working solution preparation: Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add 5-50% glycerol (final concentration) to prevent freezing damage, with 50% being the default recommendation .

  • Aliquoting: Divide the reconstituted protein into small aliquots to avoid repeated freeze-thaw cycles .

  • Working aliquots: Store working aliquots at 4°C for up to one week .

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of enzymatic activity . For working with recombinant CSLA proteins, researchers should conduct activity assays before and after storage to monitor potential activity loss.

What are the optimal conditions for assaying mannan synthase activity of recombinant CSLA11?

To effectively assay the mannan synthase activity of recombinant CSLA11, researchers should consider these methodological approaches based on protocols used for other CSLA proteins:

  • Substrate preparation:

    • GDP-mannose and GDP-glucose as potential substrates

    • Radiolabeled substrates (GDP-[14C]mannose) for sensitive detection

    • Non-radioactive assay options using HPAEC-PAD (High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection)

  • Reaction buffer components:

    • Manganese chloride (MnCl₂): 10-20 mM as cofactor

    • HEPES buffer: 50 mM, pH 7.2-7.5

    • DTT: 1-5 mM to maintain reducing environment

    • Protease inhibitor cocktail

  • Assay conditions:

    • Temperature: 30°C (optimal for plant enzymes)

    • Incubation time: 30-60 minutes

    • Termination: Boiling or adding EDTA to chelate metal ions

  • Product analysis:

    • Acid hydrolysis followed by monosaccharide composition analysis

    • Size exclusion chromatography to determine polymer length

    • Linkage analysis to confirm β-1,4 mannose and glucose linkages

The in vitro glucomannan synthase activity can be confirmed by analyzing the synthesized products using enzymatic digestion with specific mannanases, followed by oligosaccharide profiling using mass spectrometry or HPAEC-PAD .

How can the Arabidopsis super-expression system be optimized for CSLA11 production?

The Arabidopsis super-expression system represents a significant advancement for homologous recombinant protein production, particularly suitable for CSLA11 study. To optimize this system specifically for CSLA11, consider the following strategies:

  • Vector design optimization:

    • Use the rdr6-11 background to overcome transgene silencing

    • Incorporate strong promoters like 35S CaMV or tissue-specific promoters

    • Include appropriate subcellular targeting signals (ER retention, etc.)

    • Add epitope or affinity tags for purification that minimally impact function

  • Host strain selection:

    • The rdr6-11 mutant background reduces silencing of transgenes

    • Consider specific genetic backgrounds like rdr6-11 cgl1-3 or rdr6-11 fucTa fucTb xylT for modified glycosylation patterns

    • For membrane proteins like CSLA11, test different Arabidopsis accessions that might have varying membrane compositions

  • Culture optimization:

    • Maintain bacteria-free culture conditions to eliminate endotoxin contamination

    • Optimize growth media composition for protein expression

    • Determine optimal harvest time to maximize protein yield

  • Protein extraction and purification:

    • Design detergent solubilization protocols appropriate for membrane-associated glycosyltransferases

    • Implement two-step purification strategy (affinity chromatography followed by size exclusion)

    • Consider native purification approaches to maintain protein complexes if CSLA11 functions in a complex

The Arabidopsis system has yielded as much as 0.4 mg of purified protein per gram fresh weight, making it suitable for detailed biochemical and structural studies of membrane proteins like CSLA11 .

What are the key considerations for designing CSLA11 mutant studies?

When designing experiments to study CSLA11 function through mutant analysis, several critical factors should be considered:

  • Mutant generation approaches:

    • T-DNA insertion lines (available through stock centers)

    • CRISPR/Cas9 gene editing for precise modifications

    • Targeted mutagenesis of catalytic domains

    • Combination of multiple csla mutations to address functional redundancy

  • Phenotypic analysis framework:

    Analysis TypeMethodsExpected Outcomes
    Cell wall compositionHPAEC-PAD, methylation analysisChanges in mannan/glucomannan content
    Developmental phenotypingGrowth measurements, microscopyPotential embryogenesis defects (as seen with CSLA7)
    Stress responsesAbiotic/biotic stress treatmentsAltered tolerance to environmental stresses
    Gene expressionqRT-PCR, RNA-seqCompensatory expression of other CSLA genes
  • Genetic complementation strategy:

    • Testing functional equivalence with other CSLA genes (as demonstrated by CSLA9 complementing csla7)

    • Domain swapping between CSLA family members to identify functional regions

    • Heterologous complementation with orthologous genes from other species

  • Tissue-specific considerations:

    • Determine CSLA11 expression patterns across tissues and developmental stages

    • Focus phenotypic analysis on tissues with highest expression

    • Consider tissue-specific promoters for complementation experiments

Care must be taken when interpreting results from single mutants due to potential functional redundancy within the CSLA family. Studies with CSLA2, CSLA3, and CSLA9 have shown that individual knockouts may show subtle or no phenotypes, while higher-order mutants reveal more significant effects .

What techniques are most effective for characterizing CSLA11 enzyme kinetics?

For thorough characterization of CSLA11 enzyme kinetics, researchers should employ the following advanced methodological approaches:

  • Substrate specificity determination:

    • Test various nucleotide sugar donors (GDP-mannose, GDP-glucose)

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km and Vmax values for different substrates

    • Analyze product formation using chromatographic techniques

  • Kinetic parameters measurement:

    ParameterMethodSignificance
    KmVarying substrate concentrationSubstrate affinity
    VmaxSaturating substrate conditionsMaximum catalytic rate
    kcatCalculation from Vmax and enzyme concentrationTurnover number
    kcat/KmRatio calculationCatalytic efficiency
  • Inhibition studies:

    • Competitive inhibitors to identify binding site characteristics

    • Product inhibition analysis to understand reaction mechanism

    • Metal ion dependency studies (replacing Mn²⁺ with other divalent cations)

  • pH and temperature profiling:

    • Determine optimal pH range for activity

    • Establish temperature optima and stability curves

    • Assess buffer composition effects on activity

  • Advanced analytical techniques:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes during catalysis

These approaches will provide comprehensive understanding of CSLA11 catalytic properties and allow comparison with other CSLA family members to determine unique functional characteristics .

How can structural biology approaches enhance understanding of CSLA11 function?

Structural biology techniques offer powerful approaches to elucidate CSLA11 function and mechanism. Based on strategies used for related proteins, consider the following methodologies:

  • Protein structure determination approaches:

    • X-ray crystallography of purified recombinant CSLA11

    • Cryo-electron microscopy for membrane-associated complexes

    • NMR spectroscopy for domain-specific structural analysis

    • Homology modeling based on related glycosyltransferases

  • Structural-functional analysis:

    • Site-directed mutagenesis of predicted catalytic residues

    • Chimeric protein construction by domain swapping with other CSLA proteins

    • Molecular dynamics simulations to predict substrate binding and catalysis

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction validation

    • Proximity labeling approaches (BioID, APEX) to map the CSLA11 interactome

  • Localization and membrane topology:

    • Fluorescent protein fusions to determine subcellular localization

    • Protease protection assays to map membrane topology

    • Super-resolution microscopy to visualize CSLA11 distribution and dynamics

The Arabidopsis super-expression system represents an excellent platform for structural studies, as demonstrated by its successful application to the oligosaccharyltransferase (OT) complex, enabling determination of three-dimensional structure by transmission electron microscopy . Similar approaches could be applied to CSLA11, particularly if it functions as part of a larger complex involved in glucomannan synthesis.

What are the emerging trends in CSLA11 and related glycosyltransferase research?

Research on CSLA proteins, including CSLA11, continues to evolve with several promising directions:

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position CSLA11 within the broader cell wall biosynthesis pathway

    • Computational modeling of polysaccharide assembly processes

  • Biotechnological applications:

    • Engineering modified mannans with altered properties for industrial applications

    • Using CSLA11 and related enzymes for in vitro synthesis of defined oligosaccharides

    • Developing plant-based expression systems for pharmaceutical glycoproteins

  • Evolutionary perspectives:

    • Comparative analysis of CSLA functions across plant species

    • Investigation of CSLA gene family expansion and subfunctionalization

    • Understanding the evolutionary relationship between cellulose synthases and cellulose synthase-like proteins

  • Cell wall architecture:

    • Investigating the spatial organization of glucomannans within cell walls

    • Understanding the interactions between glucomannans and other cell wall components

    • Elucidating the role of CSLA-produced mannans in developmental processes beyond embryogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.