Recombinant Arabidopsis thaliana Probable mannan synthase 1 (CSLA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
CSLA1; At4g16590; dl4320w; FCAALL.402; Probable glucomannan 4-beta-mannosyltransferase 1; Cellulose synthase-like protein A1; AtCslA1; Glucomannan synthase; Mannan synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLA1
Target Protein Sequence
MSLFLKPFLFLYDTTLSLLLLLFNGWSLEDTAAAQKRREADKNAAETEWIQLQYLWTKTR SVVLLPVFKGLVVMCLVLSIIVFFESFYMNFVILFVKLFKRKPHKVYKWEAMQEDVEVGP DNYPMVLIQIPMYNEKEVFQLSIAAICSLVWPSSRLVVQVVDDSTDPAVREGVDVEIAKW QSQGINIRCERRDNRNGYKAGAMKEALTQSYVKQCDFVAVFDADFQPEPDYLIRAVPFLV HNPDVALVQARWIFVNANKCLMTRMQEMSLNYHFKVEQESGSTRHAFFGFNGTAGVWRIS AMEAAGGWKSRTTVEDMDLAVRVGLHGWKFVYLNDLTVRNELPSKFKAYRFQQHRWSCGP ANLFRKMTMEIIFNKRVSIWKKFYVIYSFFFVRKVAVHFLTFFFYCIIVPTSVFFPEIHI PSWSTIYVPSLISIFHTLATPRSFYLVIFWVLFENVMAMHRTKGTCIGLLEGGRVNEWVV TEKLGDALKSKLLSRVVQRKSCYQRVNSKEVMVGVYILGCALYGLIYGHTWLHFYLFLQA TAFFVSGFGFVGT
Uniprot No.

Target Background

Function

Probable mannan synthase with 4-beta-mannosyltransferase activity on mannan, utilizing GDP-mannose as a substrate. The resulting beta-1,4-mannan serves as the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide constituent of plant cell walls.

Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA1 and what is its function in Arabidopsis thaliana?

CSLA1 (At4g16590) is a member of the cellulose synthase-like A (CSLA) gene family in Arabidopsis thaliana, functioning as a probable mannan synthase. The CSLA family in Arabidopsis consists of nine members that encode enzymes responsible for the synthesis of mannan polysaccharides. These hemicelluloses serve dual roles as structural components of cell walls and as storage reserves during plant growth and development .

How do CSLA proteins differ from other cellulose synthase-like proteins in Arabidopsis?

CSLA proteins differ from other cellulose synthase-like (CSL) proteins in several key aspects:

CSL FamilyPrimary ProductsKey FunctionsLocalization
CSLAMannans/GlucomannansStorage reserves, structural componentsGolgi apparatus
CSLCXyloglucan backbonesCell wall matrix polysaccharidesGolgi apparatus
CSLDUnknown (possibly involved in cellulose synthesis)Root hair and pollen tube growthGolgi and plasma membrane
CSLF/H (in grasses)(1,3;1,4)-β-D-glucansCell wall polymers in grassesGolgi apparatus

Unlike CESA proteins that synthesize cellulose at the plasma membrane, CSLA proteins operate in the Golgi apparatus and produce mannans and glucomannans. While CSLDs (such as CSLD1-5) are involved in tip growth processes like root hair and pollen tube development, CSLAs participate more broadly in cell wall synthesis throughout plant tissues and embryogenesis .

What expression patterns does CSLA1 show in different Arabidopsis tissues?

CSLA1 shows distinct tissue-specific expression patterns that differ from other CSLA family members:

CSLA GenePrimary Expression SitesDevelopmental Stage
CSLA1Stems, leaves, developing seedsMultiple developmental stages
CSLA2Stems, inflorescenceAdult plants
CSLA7Embryos, developing seedsEmbryogenesis, seed development
CSLA9Stems, inflorescencePrimary and secondary cell wall formation

How can recombinant CSLA1 be expressed and purified for functional studies?

The expression and purification of recombinant CSLA1 can be achieved through the following protocol:

  • Cloning and Expression System:

    • Clone the full-length CSLA1 (1-553aa) coding sequence into a bacterial expression vector (such as pET series) with an N-terminal His-tag

    • Transform the construct into E. coli expression strains (BL21(DE3) or Rosetta)

    • Induce protein expression with IPTG (0.5-1.0 mM) at lower temperatures (16-20°C) to enhance solubility

  • Purification Protocol:

    • Lyse cells in Tris/PBS-based buffer (pH 8.0) containing appropriate protease inhibitors

    • Perform affinity chromatography using Ni-NTA columns for His-tagged protein

    • Apply size exclusion chromatography to separate different oligomeric states

    • Store purified protein in buffer containing 6% trehalose to maintain stability

  • Quality Control:

    • Confirm purity via SDS-PAGE (>90% purity is desirable)

    • Verify protein identity using Western blotting and mass spectrometry

    • Assess protein functionality through in vitro enzymatic assays

For long-term storage, aliquot the purified protein and store at -80°C with 50% glycerol to prevent freeze-thaw damage .

What methods are optimal for assessing CSLA1 enzymatic activity in vitro?

Optimal methods for assessing CSLA1 enzymatic activity include:

  • Radiochemical Assay:

    • Incubate purified CSLA1 with GDP-[14C]mannose and/or GDP-[14C]glucose substrates

    • Monitor incorporation of radioactive sugars into mannan/glucomannan products

    • Quantify using scintillation counting after product precipitation and washing

  • HPLC Analysis:

    • React CSLA1 with non-radioactive GDP-mannose and GDP-glucose

    • Hydrolyze products and analyze monosaccharide composition by HPAEC-PAD (High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection)

    • Compare mannose/glucose ratios to determine product composition

  • Mass Spectrometry:

    • Analyze reaction products using MALDI-TOF MS or ESI-MS

    • Determine degree of polymerization and mannose:glucose ratios in glucomannans

  • Activity Controls:

    • Use other well-characterized CSLA proteins (CSLA2, CSLA9) as positive controls

    • Include enzyme-free and heat-inactivated enzyme controls

    • Test activity across pH range (5.0-7.5) and different metal ion concentrations

The optimal buffer for mannan synthase activity typically contains 50 mM HEPES (pH 7.2), 5 mM MnCl₂, and 5 mM MgCl₂, with GDP-mannose and GDP-glucose as substrates at concentrations of 1-5 mM .

How does CSLA1 function compare with other CSLA family members in mannan synthesis?

The functional comparison between CSLA1 and other CSLA family members reveals important specializations:

CSLA IsoformPredominant ProductMannose:Glucose RatioTissues With Highest ActivityMutant Phenotype
CSLA1Mannan/GlucomannanHigher mannose contentVegetative tissuesSubtle vegetative defects
CSLA2Glucomannan2:1 to 1:1StemsPart of triple mutant phenotype
CSLA3Glucomannan2:1 to 1:1StemsPart of triple mutant phenotype
CSLA7Glucomannan1:1 to 1:2EmbryosEmbryo lethal
CSLA9Glucomannan3:1 to 2:1Stems, secondary cell wallsReduced stem glucomannan

While CSLA2, CSLA3, and CSLA9 collectively synthesize all detectable glucomannan in Arabidopsis stems, CSLA7 produces glucomannan specifically in embryos and is essential for embryogenesis. CSLA1 appears to have overlapping functions with other family members but may synthesize mannans with slightly different structure or in different cellular contexts .

The triple mutant csla2csla3csla9 lacks detectable glucomannan in stems but shows no alteration in stem development or strength, suggesting functional redundancy among family members. Similarly, overexpression of CSLA9 can complement the embryo lethality of csla7 mutants, indicating that the glucomannan products of different CSLA enzymes are structurally similar enough to substitute for one another functionally .

What genetic approaches can be used to study CSLA1 function in planta?

Several genetic approaches can be employed to study CSLA1 function in Arabidopsis:

  • Loss-of-Function Studies:

    • T-DNA insertional mutants from repositories like SALK, SAIL, or GABI

    • CRISPR/Cas9-mediated gene editing for precise mutations

    • RNAi or artificial microRNA for tissue-specific knockdown

    • Analysis of single csla1 mutants and higher-order mutants with other csla genes to address redundancy

  • Gain-of-Function Studies:

    • Overexpression using constitutive (35S, UBQ10) or tissue-specific promoters

    • Inducible expression systems (estrogen, dexamethasone, or ethanol-inducible)

    • Complementation of other csla mutants with CSLA1 to test functional redundancy

  • Reporter Gene Studies:

    • Promoter-GUS/GFP fusions to study spatiotemporal expression patterns

    • Protein-fluorescent protein fusions to determine subcellular localization

    • Split-YFP assays to identify protein-protein interactions in vivo

  • Conditional Approaches:

    • Temperature-sensitive alleles or conditional expression

    • Tissue-specific CRISPR systems for spatially controlled mutagenesis

When analyzing csla1 mutant phenotypes, researchers should examine multiple plant tissues and developmental stages, with particular attention to cell wall composition, using techniques such as polysaccharide immunolabeling, monosaccharide composition analysis, and linkage analysis of cell wall fractions .

How do mannan synthases interact with other cell wall biosynthesis pathways?

Mannan synthases interact with other cell wall biosynthesis pathways through several mechanisms:

  • Transcriptional Regulation Networks:

    • Transcription factors like MYB46 directly regulate both CSLA9 and cellulose synthase genes

    • ANAC041 and bZIP1 also regulate CSLA9 expression, potentially coordinating mannan and other polysaccharide synthesis

    • These transcriptional networks ensure coordinated expression of enzymes involved in synthesizing different cell wall components

  • Substrate Competition and Coordination:

    • CSLA enzymes use GDP-mannose and GDP-glucose, sharing sugar nucleotide pools with other glycosyltransferases

    • Metabolic flux between different sugar nucleotide pathways affects available substrates for various cell wall polysaccharides

    • Changes in CSLA activity can affect substrate availability for other biosynthetic processes

  • Physical Associations:

    • While CSLAs function in the Golgi, they may associate with protein complexes involved in polysaccharide synthesis and trafficking

    • Studies of other cell wall synthases (like cellulose synthase complexes) have shown that multiple enzymes can form higher-order complexes for coordinated synthesis

  • Compensatory Mechanisms:

    • Reduction in one cell wall polymer often leads to compensatory increases in others

    • The csla2csla3csla9 triple mutant lacks detectable glucomannan in stems but shows no alteration in stem strength, suggesting other cell wall components compensate for the loss

Understanding these interactions is crucial for engineering plant cell walls for various applications in biofuels, biomaterials, and crop improvement .

How can researchers design experiments to distinguish between the functions of different CSLA family members?

To distinguish between functions of different CSLA family members, researchers can implement the following experimental design strategies:

  • Combinatorial Genetic Analysis:

    • Create a complete set of single, double, triple (and higher) mutants across the CSLA family

    • Perform systematic phenotypic analysis of each mutant combination

    • Use statistical techniques like ANOVA with post-hoc tests to identify significant interactions

    • Example: The analysis showing csla2csla3csla9 triple mutants lack detectable stem glucomannan while single mutants have partial reductions

  • Tissue-Specific Analysis:

    • Combine tissue-specific promoters with CSLA coding sequences for complementation

    • Use laser capture microdissection to isolate specific cell types for expression analysis

    • Employ tissue-specific CRISPR/Cas9 systems for targeted mutagenesis

    • Design sampling scheme with proper biological replicates (n≥25) for statistical power

  • Biochemical Characterization Matrix:

    • Express all CSLA proteins recombinantly under identical conditions

    • Systematically compare substrate preferences, kinetic parameters, and product structures

    • Use standardized assay conditions with appropriate positive and negative controls

    • Create a standardized biochemical profile for each CSLA enzyme

  • Cross-Species Complementation:

    • Test whether orthologs from other species can rescue Arabidopsis csla mutants

    • Determine if CSLA1 can complement defects in other CSLA mutants (and vice versa)

    • Use heterologous expression in systems lacking endogenous mannan synthases

A robust experimental design should include proper controls, sufficient biological and technical replicates, and appropriate statistical analysis to account for natural variation in plant growth and development .

What analytical methods are most effective for characterizing cell wall mannan content and structure?

Multiple analytical methods can be combined to effectively characterize cell wall mannan content and structure:

  • Chemical Analysis Methods:

    • Monosaccharide Composition Analysis: Acid hydrolysis followed by HPAEC-PAD, GC-MS or HPLC analysis of released monosaccharides

    • Linkage Analysis: Methylation analysis followed by GC-MS to determine glycosidic linkages

    • Enzymatic Fingerprinting: Digestion with specific mannanases followed by MALDI-TOF MS or HPAEC of the released oligosaccharides

    • Size Exclusion Chromatography: Determination of molecular weight distribution of extracted mannans

  • Microscopy and Imaging Techniques:

    • Immunolabeling: Using mannan-specific antibodies (e.g., LM21, LM22) with fluorescence microscopy

    • Click Chemistry: Metabolic labeling of mannans with alkyne-functionalized monosaccharides

    • FT-IR Microspectroscopy: Spatial mapping of mannan distribution in cell walls

    • TEM with Immunogold Labeling: Ultrastructural localization of mannans

  • Physical Property Assessment:

    • Mechanical Testing: Measure tensile, compressive strength of cell walls

    • AFM: Probe nanomechanical properties of cell walls with altered mannan content

    • NMR Spectroscopy: Solid-state 13C NMR for structural characterization of intact cell walls

  • Extraction and Fractionation Protocol:

    • Sequential extraction with increasing alkali concentration (0.1M, 1M, 4M KOH)

    • CDTA extraction for loosely bound mannans

    • Enzymatic removal of cellulose and pectins to enrich for hemicelluloses

    • Anion exchange chromatography to separate neutral and charged mannans

For quantitative comparison across samples, researchers should include internal standards and express mannan content as μg per mg of alcohol-insoluble residue (AIR) or cell wall material .

How can researchers address potential functional redundancy between CSLA1 and other CSLA genes?

Addressing functional redundancy between CSLA1 and other CSLA genes requires multiple complementary approaches:

  • Higher-Order Mutant Analysis:

    • Generate comprehensive sets of double, triple, and higher-order mutants including csla1

    • Analyze phenotypes under different environmental conditions and stresses

    • Look for synthetic phenotypes that appear only in specific mutant combinations

    • Use quantitative scoring systems to detect subtle phenotypic differences

  • Expression Pattern Comparison:

    • Create detailed expression maps using transcriptomics data, promoter-reporter fusions

    • Identify tissues or developmental stages where CSLA1 is uniquely or predominantly expressed

    • Focus functional analyses on these specific contexts to minimize redundancy effects

    • Use single-cell RNA-seq to identify cell types with non-redundant expression

  • Domain Swap Experiments:

    • Create chimeric proteins between CSLA1 and other CSLA members

    • Express these under the control of various promoters in appropriate mutant backgrounds

    • Determine which protein domains confer functional specificity versus redundancy

    • Use structure-function analysis to predict critical amino acid residues

  • Substrate Specificity Analysis:

    • Compare in vitro activities with different ratios of GDP-mannose and GDP-glucose

    • Analyze structure of the polysaccharide products (mannose:glucose ratio, branching)

    • Determine kinetic parameters (Km, Vmax) for different substrates

    • Identify conditions where CSLA1 shows distinct behavior from other CSLAs

  • Evolutionary Analysis:

    • Compare CSLA sequences across plant species to identify conserved and divergent regions

    • Calculate selective pressure (dN/dS ratios) on different domains to infer functional constraints

    • Reconstruct ancestral sequences to understand evolutionary trajectory of the family

Statistical approaches such as principal component analysis can help integrate multiple phenotypic measurements to reveal patterns that distinguish the contributions of individual CSLA genes despite redundancy .

What are the key unanswered questions about CSLA1 function in Arabidopsis?

Several important questions about CSLA1 function remain unanswered:

  • Substrate Specificity and Product Structure:

    • What is the precise mannose:glucose ratio in polysaccharides produced by CSLA1?

    • Does CSLA1 produce structurally unique mannans compared to other CSLA enzymes?

    • What factors determine substrate preference between GDP-mannose and GDP-glucose?

  • Developmental Regulation:

    • What transcription factors directly regulate CSLA1 expression?

    • How is CSLA1 expression coordinated with other cell wall biosynthetic enzymes?

    • Are there specific developmental processes where CSLA1 plays a non-redundant role?

  • Protein-Protein Interactions:

    • Does CSLA1 form complexes with other proteins in the Golgi apparatus?

    • Are there specific trafficking factors that regulate CSLA1 delivery to its site of action?

    • Does post-translational modification regulate CSLA1 activity or localization?

  • Environmental Responsiveness:

    • How does CSLA1 expression and activity respond to abiotic stresses?

    • Does CSLA1 contribute to cell wall modifications during pathogen attack?

    • What environmental conditions might reveal phenotypes in csla1 mutants?

These questions highlight the need for comprehensive biochemical, genetic, and cell biological approaches to fully understand CSLA1 function in plant development and stress responses.

How can structural biology approaches enhance our understanding of CSLA proteins?

Structural biology approaches would significantly advance our understanding of CSLA proteins through:

  • High-Resolution Structure Determination:

    • X-ray crystallography or cryo-EM of CSLA proteins could reveal the catalytic mechanism

    • Structures with bound substrates or substrate analogs would elucidate the active site configuration

    • Comparison with bacterial cellulose synthases and other glycosyltransferases would reveal evolutionary relationships

    • The approach used for CESA1 catalytic domain (small-angle scattering techniques) provides a template for CSLA structural studies

  • Structure-Guided Functional Analysis:

    • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism

    • Engineering of chimeric proteins based on structural domains

    • Rational design of CSLA variants with altered substrate specificities

    • In silico docking studies with different substrates to predict product outcomes

  • Oligomeric State and Complex Formation:

    • Determine if CSLAs form homo-oligomers or hetero-oligomers in vivo

    • Study potential interactions with other Golgi-resident proteins

    • Investigate structural requirements for proper localization and trafficking

    • Compare with the trimeric organization observed for cellulose synthase catalytic domains

  • Membrane Integration and Topology:

    • Determine precise membrane topology of CSLAs in the Golgi

    • Identify regions involved in substrate access and product extrusion

    • Study potential lipid-protein interactions that may regulate activity

    • Visualize conformational changes during catalytic cycle

The structural biology approach that revealed the trimeric assembly of CESA1 catalytic domain demonstrates how small-angle neutron scattering and small-angle X-ray scattering can be applied to membrane-associated glycosyltransferases like the CSLA family .

What genetic engineering approaches utilizing CSLA1 could improve plant biomass quality?

Genetic engineering approaches utilizing CSLA1 for improving plant biomass quality include:

  • Mannan Content Modification:

    • Overexpression of CSLA1 under constitutive or tissue-specific promoters to increase mannan content

    • Coordinated expression with other cell wall-modifying enzymes for synergistic effects

    • Balance expression levels to avoid developmental defects seen with excessive glucomannan

    • Fine-tune mannose:glucose ratio for specific applications by co-expressing with other CSLAs

  • Targeted Modification for Biofuel Production:

    • Engineer plants with altered mannan structure (degree of polymerization, branching) for improved saccharification

    • Introduce controlled expression systems to induce mannan production at harvest time

    • Create feedstocks with optimal mannan:cellulose ratios for specific biofuel conversion processes

    • Decrease crystalline cellulose while increasing mannan content for improved digestibility

  • Biomaterial Applications:

    • Engineer plants to produce mannans with specific physical properties for biomaterials

    • Create designer mannans with tailored viscosity and gel-forming properties

    • Develop plant-produced mannans as alternatives to synthetic polymers

    • Introduce modified CSLAs for production of novel mannan structures not found in nature

  • Developmental Engineering:

    • Manipulate seed mannans to improve germination characteristics

    • Modify embryo development through controlled CSLA expression

    • Engineer root hair-specific mannans to improve soil penetration and nutrient uptake

    • Use cell type-specific promoters for targeted mannan modification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.