Recombinant Arabidopsis thaliana Probable mannan synthase 3 (CSLA3)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biochemical Role

CSLA3 catalyzes the transfer of mannosyl residues from GDP-mannose to form β-1,4-linked mannan backbones, with activity modulated by co-factors and interacting proteins:

  • Substrate Specificity: Utilizes GDP-mannose and GDP-glucose to synthesize glucomannan, a heteropolymer of glucose and mannose .

  • Co-Expression Effects: Co-expression with intracellular mannanases (e.g., AtMAN2/5) reduces insoluble β-mannan accumulation by 40%, suggesting hydrolytic regulation of polysaccharide deposition .

  • Catalytic Mutants: Substitution of catalytic residues (e.g., E335A in AtMAN2) abolishes activity, confirming the importance of conserved motifs .

coli Expression

  • Yield: Up to 0.4 mg of purified protein per gram of fresh weight .

  • Applications: Structural studies (e.g., oligosaccharyltransferase complexes) and enzyme activity assays .

Pichia pastoris Expression

  • Advantages: Enables post-translational modifications and soluble protein production.

  • Challenges: Toxicity from glucomannan accumulation observed in strains co-expressing CSLA3 and mannanases .

Functional Redundancy and Divergence

  • CSLA vs. CSLD Families: CSLA3 synthesizes glucomannan, while CSLD2/3 produces pure mannans. CSLA mutants lack glucomannan but retain trace mannan levels, indicating distinct roles .

  • Regulatory Elements: CSLA3’s promoter contains 64 transcriptional binding sites (vs. 35 in CSLD2), including bHLH motifs linked to root hair development .

Mutant Phenotypes

  • Embryogenesis: csla7 mutants (a CSLA homolog) exhibit arrested embryogenesis, highlighting the developmental necessity of mannan synthesis .

  • Root Hair Defects: csld3 mutants show severe root hair defects partially rescued by CSLA3 overexpression, suggesting functional overlap .

Table 2: Key Research Studies on CSLA3

Study FocusKey FindingsReferences
Enzymatic ActivityCSLA3 synthesizes β-1,4-mannan in vitro
Genetic RedundancyCSLA3 compensates for CSLD2/3 in root hairs
Biotechnological PotentialCSLA3-manipulated yeast strains enhance mannan solubility

Challenges and Future Directions

  • Protein Toxicity: High-level CSLA3 expression in Pichia inhibits growth, necessitating strain optimization .

  • Evolutionary Insights: Phylogenetic analysis reveals CSLA3’s conservation across land plants, suggesting ancient origins .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly include your request in the order details, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, kindly inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLA3; At1g23480; F28C11.11; F5O8.4; Probable glucomannan 4-beta-mannosyltransferase 3; Cellulose synthase-like protein A3; AtCslA3; Glucomannan synthase; Mannan synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLA3
Target Protein Sequence
MSPFLKFFLFLYDYLSPSSFFLVQRNTLGASLDTTDGVVRSGIIGEIIYIWKQTRIFVFI PILKCLVTICLVMSLLLFIERVYMSIVVVFVKLLRRTPEKVHKWEPINDDDLELANTNYP MVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKELVNAECDKWARKG INIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFLERTIPFLIHNHE ISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNGTAGVWRIAALNE AGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQQHRWSCGPANLW RKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFPELQVPKWA TVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKL GDTLKSKLIGKATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCA FFVAGVGYIGTFVPTV
Uniprot No.

Target Background

Function
Probable mannan synthase, consisting of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product serves as the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide found in the plant cell wall.
Database Links

KEGG: ath:AT1G23480

STRING: 3702.AT1G23480.1

UniGene: At.41547

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA3 and what is its role in plant cell wall biosynthesis?

CSLA3 (Cellulose Synthase-Like A3) is a glycosyltransferase enzyme belonging to the CSLA family in Arabidopsis thaliana that plays a crucial role in the synthesis of mannan polysaccharides, specifically glucomannan, in plant cell walls. CSLA3 functions as a mannan synthase, catalyzing the transfer of mannose from GDP-mannose onto growing polysaccharide chains or acceptors . The enzyme is part of a larger family of cellulose synthase-like proteins that are involved in the biosynthesis of various non-cellulosic polysaccharides in plant cell walls. Unlike cellulose synthases that produce β-1,4-linked glucan chains, CSLA3 and other CSLA proteins specifically produce mannans and glucomannans, which are hemicellulosic components of the cell wall . These polysaccharides have traditionally been considered structural constituents, but research suggests they may serve additional functions in plant growth and development beyond mechanical support.

How does CSLA3 function in relation to other members of the CSLA family?

CSLA3 functions cooperatively with other CSLA family members, particularly CSLA2 and CSLA9, in the synthesis of glucomannan in Arabidopsis stems. Studies using single, double, and triple mutants have revealed significant functional redundancy within this gene family . In Arabidopsis stems, CSLA2, CSLA3, and CSLA9 collectively synthesize all detectable glucomannan, with the triple mutant csla2csla3csla9 completely lacking this polysaccharide . While CSLA9 appears to contribute most significantly to stem glucomannan synthesis (with csla9 single mutants showing substantially reduced levels), CSLA3 also plays an important role in this process.

Different CSLA proteins appear to have tissue-specific functions; for example, CSLA7 synthesizes glucomannan specifically in embryos and is essential for embryogenesis, while the stem-expressed CSLA proteins (including CSLA3) do not significantly affect stem development or strength when mutated . The functional similarity between CSLA proteins is further demonstrated by the fact that overexpression of CSLA9 can complement the embryo lethality of csla7 mutants, suggesting their glucomannan products are similar despite their distinct expression patterns .

What is the biochemical function of CSLA3 in polysaccharide synthesis?

CSLA3 functions as a mannan synthase, catalyzing the formation of β-1,4-linked mannose polymers that constitute the backbone of mannans and glucomannans. Biochemically, CSLA3 transfers mannose residues from the activated sugar donor GDP-mannose onto growing polysaccharide chains . This activity has been demonstrated through in vitro enzymatic assays using isolated microsomes from plants expressing recombinant CSLA proteins . The enzyme belongs to the GT2 family of glycosyltransferases and likely utilizes a processive mechanism similar to other cell wall polysaccharide synthases.

The catalytic activity of CSLA3 requires specific structural features that are conserved among CSLA proteins, including transmembrane domains for localization to the Golgi apparatus (where mannan synthesis occurs) and catalytic motifs typical of glycosyltransferases . Unlike the distantly related CSLC, CSLF, and CSLH families, which synthesize β-1,4-glucans, the CSLA family (including CSLA3) has evolved specificity for mannose substrates, producing mannan and glucomannan polymers that have distinct functions in the plant cell wall .

How should researchers design experiments to investigate CSLA3 function in Arabidopsis?

Researchers investigating CSLA3 function should employ a multi-faceted experimental approach that accounts for the functional redundancy within the CSLA family. Single gene knockout experiments are often insufficient due to compensation by other family members, as demonstrated by the partial or minimal phenotypes observed in single csla3 mutants . Instead, researchers should:

  • Generate combinatorial mutants (double, triple) involving CSLA3 and related genes (particularly CSLA2 and CSLA9) using T-DNA insertion lines or CRISPR/Cas9 technology. This approach revealed that the triple csla2csla3csla9 mutant completely lacks detectable glucomannan in stems, whereas single mutants show less dramatic reductions .

  • Complement these genetic approaches with biochemical assays using recombinant proteins. For example, microsomes isolated from plants overexpressing CSLA3 can be used in in vitro enzymatic assays where mannose from GDP-mannose is transferred onto endogenous acceptors, confirming mannan synthase activity .

  • Employ tissue-specific promoters for expression studies to determine where and when CSLA3 is active. This is crucial given evidence that different CSLA proteins have tissue-specific functions (e.g., CSLA7 in embryos versus CSLA3 in stems) .

  • Use overexpression studies to assess gain-of-function phenotypes. Overexpression of CSLA proteins, including CSLA3, has been shown to increase glucomannan content in stems and can affect developmental processes like embryogenesis .

  • Analyze cell wall composition through techniques like methylation analysis, immunolabeling with mannan-specific antibodies, and enzymatic fingerprinting to quantitatively assess the impact of CSLA3 manipulation on glucomannan content and structure.

What approaches can be used to analyze the functional redundancy between CSLA3 and other CSLA family members?

To thoroughly analyze functional redundancy between CSLA3 and other CSLA family members, researchers should implement the following approaches:

  • Comparative Genomic Analysis: Conduct detailed sequence comparison and evolutionary analysis of CSLA3 and related genes. This approach has been useful for understanding relationships between similar genes such as CSLD2 and CSLD3, which showed high sequence homology and similar intron/exon organization .

  • Expression Pattern Analysis: Compare the expression profiles of CSLA genes across different tissues and developmental stages using techniques like RNA-seq, qRT-PCR, or promoter-reporter fusions. This helps identify overlapping expression domains that suggest redundant functions.

  • Genetic Complementation Tests: Perform cross-complementation experiments where one CSLA gene is expressed under the control of another CSLA gene's promoter in the corresponding mutant background. For example, the fact that CSLA9 overexpression can complement csla7 embryo lethality suggests functional redundancy between these proteins .

  • Biochemical Characterization: Compare the enzymatic properties (substrate specificity, kinetic parameters) of recombinant CSLA proteins in vitro. This can reveal subtle differences in catalytic activity that might explain partial redundancy.

  • Higher-Order Mutant Analysis: Generate and characterize double, triple, and higher-order mutants in different combinations of CSLA genes. The analysis of csla2csla3csla9 triple mutants revealed complete loss of stem glucomannan, while single or double mutants retained some activity, demonstrating partial redundancy .

  • Domain Swapping Experiments: Create chimeric proteins by swapping domains between different CSLA proteins to identify regions responsible for specific functions or localization patterns, similar to experiments where the CSLD3 catalytic domain was replaced with the CESA6 catalytic domain .

What are the best methods for quantifying glucomannan content in CSLA3 mutant plants?

For accurate quantification of glucomannan content in CSLA3 mutant plants, researchers should employ multiple complementary techniques:

When analyzing CSLA3 mutants, researchers should employ these techniques on carefully selected tissues where CSLA3 is known to be expressed, and always include appropriate controls (wild-type, other csla mutants, and complemented lines) for comparative analysis.

How does the structure and function of recombinant CSLA3 compare to native CSLA3 in plants?

The structure and function of recombinant CSLA3 compared to native CSLA3 in plants involves several important considerations:

  • Protein Folding and Post-translational Modifications: Recombinant CSLA3 expressed in heterologous systems (e.g., E. coli as mentioned in search result ) may lack plant-specific post-translational modifications such as glycosylation, phosphorylation, or proper disulfide bond formation. These modifications can influence protein stability, localization, and catalytic activity. Researchers should consider expression systems like plant cell cultures or insect cells that might better preserve such modifications.

  • Membrane Integration: Native CSLA3 is an integral membrane protein localized to the Golgi apparatus, with multiple transmembrane domains that anchor it in the membrane. Recombinant proteins may not properly integrate into membranes in heterologous systems, potentially affecting their catalytic function. When expressing full-length CSLA3 (like the 1-551 amino acid protein mentioned in ), researchers should verify proper membrane integration.

  • Catalytic Activity: In vitro assays with recombinant CSLA3 can demonstrate mannan synthase activity, but the efficiency may differ from native conditions. This could be due to differences in lipid environment, absence of associated proteins, or altered protein conformation. Microsomal preparations from plants overexpressing CSLA proteins have shown mannan synthase activity in vitro , suggesting that recombinant proteins can retain function when properly expressed.

  • Protein Complexes: Growing evidence suggests that plant cell wall synthases often function in complexes. For instance, CSLD proteins have been shown to potentially form multimeric complexes for non-cellulosic polysaccharide synthesis . Recombinant CSLA3 expressed in isolation may lack interaction partners that modulate its activity or specificity in vivo.

  • Substrate Accessibility: In native conditions, CSLA3 likely has optimal access to its substrates (GDP-mannose) and acceptors within the Golgi apparatus. Reconstituting these conditions in vitro with recombinant proteins presents challenges that may affect enzymatic efficiency.

Researchers should validate recombinant CSLA3 function through complementation studies, where the recombinant gene is expressed in csla3 mutant backgrounds to determine if it can restore the wild-type phenotype. Additionally, comparing the enzymatic properties of recombinant CSLA3 with activities measured in plant microsomes can provide insights into functional differences.

What is the optimal approach for heterologous expression of functional CSLA3 protein?

The optimal approach for heterologous expression of functional CSLA3 protein requires careful consideration of expression systems, protein structure, and downstream applications:

  • Selection of Expression System:

    • Plant-based Systems: Nicotiana benthamiana transient expression using Agrobacterium infiltration provides a plant-based environment that supports proper folding and post-translational modifications of plant proteins. This system has been used successfully for expressing CSLD proteins and analyzing their mannan synthase activity in isolated microsomes .

    • Insect Cell Systems: Baculovirus-infected insect cells (Sf9, Sf21, or High Five) offer eukaryotic processing machinery while providing higher yields than plant systems.

    • Yeast Systems: Pichia pastoris or Saccharomyces cerevisiae can express membrane proteins with proper folding and some post-translational modifications.

    • Bacterial Systems: While E. coli has been used to express full-length CSLA3 (as seen in search result ), this system may not provide optimal folding for plant membrane proteins. If using E. coli, specialized strains (C41/C43) designed for membrane protein expression should be considered.

  • Construct Design:

    • Include appropriate affinity tags (His, FLAG, etc.) for purification while ensuring they don't interfere with protein function.

    • Consider using fusion partners (MBP, SUMO, etc.) to enhance solubility if expression yields are poor.

    • For functional studies, the full-length protein (1-551 amino acids for rice CSLA3 ) should be used to preserve all transmembrane domains and catalytic regions.

  • Expression Conditions:

    • For membrane proteins like CSLA3, lower expression temperatures (16-25°C) often improve proper folding.

    • Induction conditions should be optimized to balance expression level with proper folding.

    • For plant-based expression, consider co-expression with chaperones or other CSLA family members if complex formation is suspected to be important for function.

  • Protein Extraction and Purification:

    • Use mild detergents (DDM, LMNG, etc.) for extraction from membranes.

    • Implement a two-step purification strategy (e.g., affinity chromatography followed by size exclusion) to obtain pure, homogeneous protein.

    • Consider preparing microsomes rather than purified protein for activity assays, as this preserves the membrane environment and potentially important associated factors .

  • Functional Verification:

    • Mannan synthase activity can be assessed using in vitro assays with GDP-mannose as substrate and analyzing product formation by chromatographic or spectroscopic methods .

    • Recombinant protein should be tested in complementation assays with csla mutants to verify biological function.

How can researchers effectively generate and characterize CSLA3 mutants?

Researchers seeking to generate and characterize CSLA3 mutants should follow this systematic approach:

  • Mutant Generation Strategies:

    • T-DNA Insertion Lines: Utilize available T-DNA insertion collections (SALK, SAIL, GABI-Kat) to obtain csla3 knockout or knockdown lines. These resources have been successfully used to study CSLA genes in Arabidopsis .

    • CRISPR/Cas9 Gene Editing: Design guide RNAs targeting conserved regions of CSLA3, particularly the catalytic domain. This approach allows creation of precise mutations and can be useful for generating mutations in multiple CSLA genes simultaneously.

    • Point Mutation Approaches: For studying specific protein domains, consider using CRISPR/Cas9 base editing or traditional site-directed mutagenesis in complementation constructs.

    • Combinatorial Mutants: Generate double and triple mutants with other CSLA genes (particularly CSLA2 and CSLA9) to address functional redundancy issues .

  • Genotyping and Expression Analysis:

    • Confirm mutations by PCR-based genotyping, sequencing, and RT-PCR/qPCR to verify altered gene expression.

    • For T-DNA lines, ensure the insertion disrupts protein function by checking for presence of truncated transcripts.

    • Analyze expression of other CSLA genes to identify potential compensatory changes in related genes.

  • Phenotypic Characterization:

    • Developmental Analysis: Assess plant growth parameters, with particular attention to tissues where CSLA3 is highly expressed. While csla3 single mutants may show subtle phenotypes, double or triple mutants may exhibit more pronounced effects .

    • Cell Wall Analysis: Quantify glucomannan content using the methods described in FAQ 2.3. Compare results with wild-type and other csla mutants to determine CSLA3's specific contribution to mannan synthesis.

    • Microscopy: Perform detailed anatomical analysis using light and electron microscopy to detect subtle alterations in cell wall structure or cellular morphology.

    • Stress Response Tests: Evaluate responses to abiotic and biotic stresses, as cell wall composition can affect plant stress tolerance.

  • Functional Complementation:

    • Create complementation constructs with the wild-type CSLA3 gene under control of its native promoter or a suitable substitute.

    • Transform mutant plants and select multiple independent transgenic lines for analysis.

    • Verify restoration of glucomannan synthesis and reversal of any phenotypic abnormalities.

    • Consider cross-complementation experiments using other CSLA genes to test functional equivalence.

  • Data Validation and Controls:

    • Always include appropriate controls (wild-type, known csla mutants, complemented lines) in all experiments.

    • Use multiple independent mutant alleles or lines to confirm that observed phenotypes are due to CSLA3 disruption rather than background mutations.

    • Perform statistical analysis to quantify the significance of observed differences.

What in vitro assay systems can be used to study CSLA3 enzymatic activity?

Several in vitro assay systems can be employed to study CSLA3 enzymatic activity, each with specific advantages and applications:

  • Microsomal Fraction Assays:

    • Sample Preparation: Isolate microsomes from plants expressing native or recombinant CSLA3. This approach has been successfully used to demonstrate mannan synthase activity in tobacco plants overexpressing Arabidopsis CSLA proteins .

    • Reaction Conditions: Incubate microsomes with GDP-mannose (and GDP-glucose for glucomannan synthesis) in appropriate buffer conditions (pH 7-7.5, presence of Mg²⁺ or Mn²⁺).

    • Activity Detection: Monitor incorporation of radioactive [¹⁴C]GDP-mannose into polymer fraction, or use non-radioactive methods with specific product detection by chromatography or mass spectrometry.

    • Advantages: Preserves the native membrane environment and potentially important associated factors; relatively simple preparation.

  • Purified Recombinant Protein Assays:

    • Protein Source: Express and purify full-length CSLA3 with appropriate tags (as described in search result ) using detergent solubilization and affinity chromatography.

    • Reconstitution Systems: Incorporate purified protein into liposomes or nanodiscs to provide a controlled membrane environment.

    • Activity Analysis: Monitor product formation using similar methods as for microsomes, with additional options for kinetic analysis due to the defined protein concentration.

    • Advantages: Allows direct attribution of activity to CSLA3; enables detailed kinetic and mechanistic studies; eliminates confounding activities from other proteins.

  • Acceptor-Based Assays:

    • Principle: Provide exogenous acceptors (short mannooligosaccharides or fluorescently labeled acceptors) to monitor elongation rather than de novo synthesis.

    • Detection Methods: Use size-exclusion chromatography, HPAEC-PAD, or fluorescence-based detection to monitor acceptor elongation.

    • Applications: Particularly useful for studying the processivity and directionality of mannan synthesis, as well as substrate specificity.

  • Product Characterization Methods:

    • Enzymatic Digestion: Treat reaction products with specific endo-β-mannanases followed by oligosaccharide analysis to confirm mannan structure.

    • Linkage Analysis: Perform methylation analysis coupled with GC-MS to determine glycosidic linkage patterns in the synthesized polymers.

    • NMR Spectroscopy: For larger-scale preparations, use NMR to characterize the structure of the synthesized polysaccharides.

A comprehensive assay protocol should include:

  • Carefully optimized reaction conditions (pH, temperature, cation requirements)

  • Time-course analysis to determine linear range of activity

  • Substrate concentration variation to determine kinetic parameters

  • Controls including heat-inactivated enzyme and microsomes from plants not expressing CSLA3

  • Verification of product identity through multiple analytical methods

In vitro mannan synthase activity assays have successfully demonstrated that tobacco microsomes expressing Arabidopsis CSLD5 or CSLD2/CSLD3 could synthesize mannan by transferring mannose from GDP-mannose onto endogenous acceptors . Similar approaches can be applied to study CSLA3 activity.

What techniques can be used to study the interaction between CSLA3 and other cell wall biosynthetic enzymes?

Investigating the interactions between CSLA3 and other cell wall biosynthetic enzymes requires a multi-faceted approach utilizing both in vivo and in vitro techniques:

  • Co-Immunoprecipitation (Co-IP):

    • Express epitope-tagged versions of CSLA3 (e.g., HA, FLAG, or GFP tags) in Arabidopsis or a heterologous system.

    • Solubilize membranes using mild detergents that preserve protein-protein interactions.

    • Immunoprecipitate CSLA3 using tag-specific antibodies and identify interacting partners by mass spectrometry.

    • Verify specific interactions with candidate partners using reverse Co-IP experiments.

    • This approach can identify both stable and transient interactions within the cellular context.

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse CSLA3 and potential interacting partners to complementary fragments of a fluorescent protein (e.g., split YFP).

    • Express these constructs in plant cells (protoplasts or tobacco leaves via Agrobacterium infiltration).

    • Observe fluorescence restoration when proteins interact, with subcellular localization providing additional contextual information.

    • This technique allows visualization of interactions in living cells and can indicate where in the cell these interactions occur.

  • Förster Resonance Energy Transfer (FRET):

    • Tag CSLA3 and potential partners with appropriate fluorophore pairs (e.g., CFP/YFP).

    • Measure energy transfer between fluorophores when proteins are in close proximity (typically <10 nm).

    • This technique provides quantitative data on interaction strength and can detect dynamic interactions.

  • Yeast Two-Hybrid (Y2H) and Split-Ubiquitin Systems:

    • For membrane proteins like CSLA3, the split-ubiquitin system is more appropriate than conventional Y2H.

    • This approach can be used for initial screening of potential interacting partners.

    • Positive interactions should be validated using in planta methods due to potential false positives.

  • Co-expression Analysis:

    • Analyze transcriptomic datasets to identify genes co-expressed with CSLA3 across different tissues and conditions.

    • Co-expressed genes often function in the same pathway or complex.

    • This approach has been useful in identifying components of cell wall biosynthetic complexes.

  • Genetic Interaction Studies:

    • Generate double mutants between csla3 and mutants in other cell wall biosynthesis genes.

    • Analyze phenotypes for evidence of genetic interactions (synthetic lethality, enhancement, or suppression).

    • For example, studies with csld mutants revealed complex interactions between CSLD2, CSLD3, and CSLD5 in cell wall biosynthesis .

  • Biochemical Complex Isolation:

    • Use blue native PAGE or size exclusion chromatography to isolate native protein complexes containing CSLA3.

    • Identify components by mass spectrometry or immunoblotting.

    • This approach can provide information on the size and composition of potential multiprotein complexes.

  • Proximity Labeling:

    • Fuse CSLA3 to enzymes like BioID or TurboID that biotinylate nearby proteins.

    • Express these constructs in plants, isolate biotinylated proteins, and identify them by mass spectrometry.

    • This technique can capture both stable and transient interactions in the native cellular environment.

Evidence suggests that cell wall synthases may function in complexes, as indicated by research on CSLD proteins . Similar principles may apply to CSLA3, making the investigation of protein-protein interactions particularly relevant for understanding its function in glucomannan synthesis.

How should researchers interpret changes in glucomannan content in CSLA3 mutant plants?

Interpreting changes in glucomannan content in CSLA3 mutant plants requires careful consideration of multiple factors:

  • Quantitative Assessment:

    • Baseline Comparison: Always compare glucomannan levels to wild-type plants grown under identical conditions. Establish normal variation in wild-type plants through biological replicates.

    • Tissue Specificity: Analyze multiple tissue types separately, as CSLA3 may have tissue-specific expression patterns and contributions to glucomannan synthesis. For example, CSLA genes show differential expression across plant tissues, with some predominantly active in stems and others in embryos .

    • Developmental Timing: Assess glucomannan content at multiple developmental stages, as the importance of CSLA3 may vary during plant growth.

  • Redundancy Considerations:

    • Partial vs. Complete Reduction: Single csla3 mutants may show only partial reduction in glucomannan due to functional redundancy with other CSLA genes. Studies have shown that while csla9 single mutants exhibit substantially reduced glucomannan, complete loss is only observed in triple csla2csla3csla9 mutants .

    • Compensatory Mechanisms: Check for upregulation of other CSLA genes in csla3 mutants, which might partially compensate for the loss of CSLA3 function.

  • Structural Analysis:

    • Polymer Characteristics: Beyond quantitative changes, assess qualitative characteristics of remaining glucomannan, including degree of polymerization, mannose-to-glucose ratio, and substitution patterns.

    • Wall Integration: Determine whether the reduced glucomannan affects the cross-linking or integration with other wall polymers through sequential extraction and fractionation experiments.

  • Phenotypic Correlation:

    • Growth Phenotypes: Correlate glucomannan reduction with observable phenotypes. Interestingly, csla mutants with reduced stem glucomannan showed no alteration in stem development or strength, challenging assumptions about glucomannan's structural role .

    • Stress Responses: Evaluate whether decreased glucomannan affects responses to biotic or abiotic stresses, which might reveal conditional functions.

  • Interpretation Framework:

    • Threshold Effects: Consider that biological systems often exhibit threshold effects, where phenotypes appear only when a component drops below a critical level.

    • Context Dependency: The importance of glucomannan may vary with environmental conditions, genetic background, and developmental stage.

    • Functional Redundancy: Interpret results in the context of the entire CSLA family, recognizing that multiple enzymes may contribute to the same polysaccharide pool with different efficiency or regulation.

  • Data Presentation:

    • Present data in a comprehensive table format that includes:

    GenotypeStem Glucomannan (μg/mg cell wall)Root Glucomannan (μg/mg cell wall)Embryo Glucomannan (μg/mg cell wall)Observable Phenotypes
    Wild-type[value ± SD][value ± SD][value ± SD]None
    csla3[value ± SD][value ± SD][value ± SD][description]
    csla2csla3[value ± SD][value ± SD][value ± SD][description]
    csla3csla9[value ± SD][value ± SD][value ± SD][description]
    csla2csla3csla9[value ± SD][value ± SD][value ± SD][description]

Research has shown that while CSLA2, CSLA3, and CSLA9 are collectively responsible for all detectable glucomannan in Arabidopsis stems, the absence of this polysaccharide in triple mutants does not significantly affect stem development or strength . This unexpected finding challenges conventional assumptions about glucomannan's structural role and illustrates the importance of correlating biochemical changes with phenotypic observations.

How can researchers address contradictory results when studying CSLA3 function?

Addressing contradictory results in CSLA3 research requires systematic investigation and critical analysis:

  • Methodological Reconciliation:

    • Technique Variability: Different analytical methods for glucomannan quantification (immunological, chemical, enzymatic) may yield varying results. Verify findings using multiple independent techniques.

    • Extraction Efficiency: Variations in cell wall extraction protocols can affect glucomannan recovery. Standardize extraction methods or compare extraction efficiency using internal standards.

    • Assay Sensitivity: Ensure methods are sufficiently sensitive to detect small changes in glucomannan content, especially in single mutants where reductions might be subtle.

  • Experimental Context Assessment:

    • Growth Conditions: Environmental factors (light, temperature, nutrients) can significantly affect cell wall composition. Standardize growth conditions and report them comprehensively.

    • Developmental Stage: Collect samples at precisely defined developmental stages, as glucomannan content and CSLA3 contribution may vary temporally.

    • Tissue Specificity: Apparent contradictions may arise from analyzing different tissues. For example, CSLA7 is essential in embryos while CSLA2/3/9 function primarily in stems .

  • Genetic Background Considerations:

    • Ecotype Differences: Different Arabidopsis ecotypes may show varied dependency on CSLA3. Always specify the genetic background and consider testing in multiple ecotypes.

    • T-DNA Position Effects: For T-DNA insertion mutants, the insertion position affects the severity of gene disruption. Characterize multiple independent alleles of csla3.

    • Secondary Mutations: Backcross mutant lines to wild type to eliminate potential background mutations that might influence results.

  • Data Integration Framework:

    • Gene Expression Context: Correlate functional results with expression data. If CSLA3 is minimally expressed in a tissue, its mutation would predictably have limited impact there.

    • Protein Interactions: Consider that CSLA3 may function in complexes with other proteins, and the presence/absence of these partners could explain tissue-specific contradictions.

    • Functional Redundancy: Systematically address redundancy through analysis of higher-order mutants, as demonstrated by the complete loss of glucomannan only in csla2csla3csla9 triple mutants .

  • Specific Contradictory Scenarios and Resolutions:

    Contradictory ObservationPotential ExplanationResolution Approach
    CSLA3 mutation shows phenotype in lab A but not lab BDifferent growth conditions or developmental timingStandardize conditions; exchange seeds and protocols
    In vitro CSLA3 activity differs from expected in vivo functionMissing cofactors or interacting partners in vitroUse microsomes rather than purified protein; add potential cofactors
    csla3 mutants show no glucomannan reduction despite CSLA3 expression in that tissueFunctional compensation by other CSLA genesAnalyze expression of other CSLA genes; create higher-order mutants
    Overexpression of CSLA3 fails to increase glucomannan in certain tissuesLimiting substrate availability or missing accessory factorsSupply precursors; co-express with potential partners
    CSLA3 appears to synthesize different products in different studiesDifferences in available acceptors or analysis methodsCharacterize products using multiple analytical techniques
  • Collaborative Verification:

    • When persistent contradictions occur, arrange inter-laboratory validation studies with standardized materials and protocols.

    • Consider publishing contradictory results with thorough documentation of methods, as these can highlight important biological variables.

The case of CSLA function illustrates how apparent contradictions can reveal biological nuance. While csla mutants with no detectable stem glucomannan showed no stem strength phenotype , other work has shown that glucomannan is important for embryogenesis . These apparently contradictory results actually reveal tissue-specific functions of these polysaccharides rather than representing true experimental contradictions.

What are the current gaps in our understanding of CSLA3 function and glucomannan synthesis?

Despite significant advances in our understanding of CSLA3 and glucomannan synthesis, several important knowledge gaps remain:

  • Biochemical Mechanism and Regulation:

    • The precise catalytic mechanism of CSLA3 remains poorly characterized, including how it selects between GDP-mannose and GDP-glucose for glucomannan synthesis.

    • The regulatory factors controlling CSLA3 activity (post-translational modifications, allosteric regulators, etc.) are largely unknown.

    • The stoichiometry of glucose to mannose in glucomannans produced by CSLA3 versus other CSLA proteins has not been systematically compared.

  • Protein Interactions and Complex Formation:

    • Whether CSLA3 functions as a homodimer, heterodimer with other CSLA proteins, or as part of larger complexes remains unclear.

    • The potential interaction between CSLA3 and other cell wall biosynthetic enzymes has not been thoroughly investigated, though evidence suggests that related glycosyltransferases like CSLD proteins may form complexes .

    • The subcellular trafficking and localization mechanisms for CSLA3 are not fully elucidated.

  • Developmental and Physiological Roles:

    • The specific biological functions of glucomannan produced by CSLA3 in different tissues remain unclear, especially given the finding that stem glucomannan absence does not affect stem strength .

    • The potential roles of CSLA3-produced glucomannan in stress responses, pathogen resistance, or signaling have not been thoroughly explored.

    • The developmental processes that specifically require CSLA3 activity, as opposed to other CSLA proteins, remain to be fully defined.

  • Evolutionary Context:

    • The evolutionary forces driving the maintenance of multiple CSLA genes with apparently redundant functions are not well understood.

    • The functional diversification of CSLA proteins across different plant species and how this relates to cell wall composition differences remains to be fully characterized.

    • Whether CSLA3 orthologs in other species have conserved or divergent functions has not been comprehensively investigated.

  • Technical Challenges:

    • Current methods for in situ visualization of glucomannan deposition have limited resolution, making it difficult to track newly synthesized glucomannan.

    • Techniques for dynamically monitoring CSLA3 activity in living cells are lacking.

    • The availability of specific inhibitors for CSLA3 that could be used as research tools is limited.

  • Applied Aspects:

    • The potential for manipulating CSLA3 and glucomannan content for improving plant biomass characteristics or stress resistance has not been fully explored.

    • The impact of altered glucomannan structure or content on downstream applications (biofuels, materials, etc.) remains to be systematically assessed.

Addressing these gaps will require innovative approaches combining structural biology, advanced imaging, systems biology, and synthetic biology techniques. Particularly promising directions include cryo-EM studies of CSLA3 structure, development of activity-based probes for glycosyltransferases, and application of proximity labeling techniques to identify interacting partners in specific cellular contexts.

What novel experimental approaches might advance our understanding of CSLA3 function?

Several innovative experimental approaches could significantly advance our understanding of CSLA3 function:

  • Advanced Structural Biology Techniques:

    • Cryo-Electron Microscopy: Apply cryo-EM to determine the structure of CSLA3 in its native membrane environment, potentially capturing different conformational states during catalysis.

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Use HDX-MS to identify dynamic regions of CSLA3 and conformational changes upon substrate binding or interaction with other proteins.

    • Single-Particle Tracking: Apply super-resolution microscopy combined with protein tagging to track the movement and clustering of CSLA3 molecules in living cells.

  • Genome Editing and Synthetic Biology:

    • Domain Swapping Using CRISPR: Create precise chimeric proteins by swapping domains between different CSLA family members to identify regions responsible for specific functions or substrate specificities.

    • Promoter Swapping: Exchange native promoters of CSLA genes using CRISPR-based approaches to alter expression patterns and test functional redundancy in different tissues.

    • Orthogonal Glycosyltransferase Systems: Introduce engineered glycosyltransferases that produce non-native polysaccharides to probe the structural and functional roles of glucomannan without disrupting native synthesis machinery.

  • Advanced Imaging and In Situ Detection:

    • Click Chemistry for Polysaccharide Labeling: Incorporate modified sugar precursors that can be detected via bioorthogonal click chemistry to track newly synthesized glucomannan.

    • Expansion Microscopy: Apply tissue expansion techniques combined with glucomannan-specific probes to visualize glucomannan distribution at nanoscale resolution.

    • Correlative Light and Electron Microscopy (CLEM): Combine fluorescence imaging of tagged CSLA3 with electron microscopy to correlate protein localization with ultrastructural features.

  • Systems Biology Approaches:

    • Multi-omics Integration: Combine transcriptomics, proteomics, metabolomics, and glycomics data from csla3 mutants to build comprehensive models of glucomannan synthesis and its impact on cellular processes.

    • Single-Cell RNA-Seq: Apply single-cell transcriptomics to tissues expressing CSLA3 to identify cell-specific expression patterns and potential regulatory networks.

    • Network Analysis: Use weighted gene co-expression network analysis (WGCNA) to identify genes and pathways functionally associated with CSLA3 across different tissues and conditions.

  • Novel Biochemical and Biophysical Methods:

    • Reconstitution in Synthetic Membranes: Reconstitute CSLA3 in synthetic membrane systems (nanodiscs, liposomes) with defined lipid composition to study the impact of membrane environment on activity.

    • Single-Molecule Enzymology: Develop methods to monitor the activity of individual CSLA3 molecules to characterize kinetic heterogeneity and processivity.

    • Activity-Based Protein Profiling: Develop chemical probes that covalently label active CSLA enzymes to monitor active enzyme populations in different tissues or conditions.

  • In Vivo Proximity Labeling:

    • TurboID or APEX2 Fusions: Create CSLA3 fusions with proximity labeling enzymes to identify proteins in close proximity to CSLA3 in living cells, potentially revealing transient interaction partners.

    • Split-BioID Approaches: Use split proximity labeling systems to identify protein-protein interactions specifically when CSLA3 is actively engaged in glucomannan synthesis.

  • Computational and Modeling Approaches:

    • Molecular Dynamics Simulations: Model CSLA3 structure, substrate binding, and catalytic mechanism using advanced simulation techniques.

    • Machine Learning for Function Prediction: Apply machine learning to identify subtle sequence features that might predict specific functions or interactions of CSLA family members.

    • Mathematical Modeling of Synthesis: Develop mathematical models of glucomannan synthesis incorporating enzyme kinetics, substrate availability, and regulatory mechanisms.

These innovative approaches could help resolve current gaps in our understanding of CSLA3 function, particularly regarding its catalytic mechanism, in vivo dynamics, interaction partners, and tissue-specific roles in glucomannan synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.